KEGG   Thermoanaerobacter sp. X514: Teth514_0992Help
Entry
Teth514_0992      CDS       T00648                                 

Definition
ROK family glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tex  Thermoanaerobacter sp. X514
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tex00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Teth514_0992
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Teth514_0992
   00052 Galactose metabolism
    Teth514_0992
   00500 Starch and sucrose metabolism
    Teth514_0992
   00520 Amino sugar and nucleotide sugar metabolism
    Teth514_0992
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Teth514_0992
   00524 Butirosin and neomycin biosynthesis
    Teth514_0992
Enzymes [BR:tex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Teth514_0992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1023990..1024928
Genome map
AA seq 312 aa AA seqDB search
MRIGVDLGGTNIAVGLVDEEGRIVATDSRPTKPERGYEAIAKDIADIAFELIKRSNLSVS
DIKSMGIGVPGVADSEKGIVIRAVNLFWTKVPLAKEIRKYIDLPIYMGNDANVAALAEAI
FGAGKGSKSSITLTLGTGVGSGFILDGKIYNCAHHFALELGHIVIGDNGVRCNCGKIGCL
ETYASATALIREGKKAVEKNPNSLILKLANGDIESITAKNVIDAAKQYDEQAMRIFNDYV
KYLAVGIVNVINMFDPEVIILGGGVANTGDFLIKPLKKEVAENILFKDLPYADIRKAELG
NDAGIIGAAILD
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagaattggcgttgaccttggaggcactaacatagctgttggattagtggatgaagaa
ggacgtatagtagctacagatagcagaccgacaaaaccggaaagaggttatgaggcgatt
gccaaagacatagcggatatagcttttgaacttattaagaggagtaatctaagtgtaagt
gacattaagtcaatgggaataggagtcccgggtgtagcagatagcgaaaaaggcatagta
atacgagcggtgaatctcttttggacaaaagttccccttgcaaaagaaataagaaaatac
attgatttgccaatatatatgggcaatgatgcaaatgtagcggctttggcagaggcgata
tttggcgctggtaaaggctcaaagtcctctatcacgcttactttaggtacaggagtagga
tctggctttattctcgacggcaaaatatacaactgtgctcatcattttgcacttgagctt
ggacacatagtgataggagacaatggtgtaaggtgtaactgtggtaagattggatgtttg
gaaacatatgcttcagctactgctttaataagagaagggaaaaaagcagtagagaagaat
cccaattctcttattttaaaattggcaaatggggatatagaaagcataacagctaaaaat
gtaattgatgctgcaaagcagtatgatgagcaagcgatgagaattttcaatgattatgtc
aaatacctggctgttggaattgtcaatgtcataaacatgtttgaccctgaagtgataata
ttgggtggcggcgttgcaaatacgggagattttctcataaaacccctcaaaaaagaagtg
gcggaaaatattttgtttaaagaccttccttatgctgacataaggaaagcagaacttgga
aatgatgcgggaataattggtgcagctatattagattaa

DBGET integrated database retrieval system