KEGG   Thermoanaerobacter sp. X514: Teth514_1020Help
Entry
Teth514_1020      CDS       T00648                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tex  Thermoanaerobacter sp. X514
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tex00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Teth514_1020
Enzymes [BR:tex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Teth514_1020
Exosome [BR:tex04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Teth514_1020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1049795..1051288
Genome map
AA seq 497 aa AA seqDB search
MAKYIMAFDQGTTSSRAIIFDHSGKIVASQNQEFKQIYPKAGWVEHDPMEIWGTQIGVAK
GVIEKAGINPEDIAAIGITNQRETTVVWDKNTGKPIYNAIVWQCRRTAPICDELKNKGFD
KKIREKTGLVVDAYFSGTKIKWILDNVEGAREKAEKGELLFGNIDTWLIWNLTRGKVHVT
DYSNASRTMLFNIHELKWDKEILEELNVPEQMLPEVKPSSYVYGYTDKSIFGVEIPIAGD
AGDQQAALFGQACFKPGMAKNTYGTGCFMLMNTGEKAVPSNTGLLTTIAWGIDGKVEYAL
EGSIFIAGAAIQWLRDELRIIDNSPQSEEYALKVEDTNGVYVVPAFVGLGAPYWDMYARG
TIVGLTRGAKREHIIRATLESIAYQTRDVLEAMQEDSGIKLQALKIDGGASANNFLMQFQ
SDILGVPVDRPQVIETTALGASYLAGLAVGFWNSKEEIEKNWNVDKHFEPAMDNEKREKL
YKGWKKAVERAMKWAEE
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagtacattatggcttttgaccaggggacaacaagttcccgtgcgataattttt
gaccatagtgggaaaattgtggcttcacaaaatcaagaatttaagcaaatttatcctaag
gcaggttgggtagaacatgatccaatggagatatggggtacacaaataggtgttgcaaaa
ggtgttatagaaaaagcgggtattaatccggaggatattgcagctattggcattacaaat
cagagagagacaactgttgtatgggataaaaatacaggaaaacctatttacaatgcaata
gtgtggcaatgcagaagaactgctcctatatgcgatgaactaaaaaataaaggttttgac
aagaaaattagagaaaaaaccggacttgtagtagatgcatatttttctggtactaaaata
aaatggattttggataatgttgaaggagcaagagaaaaagcagaaaaaggagaattgctt
tttggaaatattgatacctggcttatttggaatttgacaaggggtaaggtacacgtaact
gactattctaatgcgtcaaggacgatgctttttaatatccatgaattaaaatgggataaa
gagatattagaagaacttaatgtcccagagcaaatgcttcctgaagttaagccttccagt
tatgtatatggctatactgataaaagtatatttggagtagagatacctattgccggagat
gcgggagaccagcaggcagctttgtttggtcaagcctgtttcaaacctgggatggcaaaa
aacacctatggaacaggctgctttatgctcatgaatactggtgaaaaggctgtaccttcc
aatactggacttctcactacaatcgcttggggaattgatggcaaagtagaatatgcctta
gagggtagtatatttatagcaggtgctgcgatacagtggctgagagacgagcttagaata
attgacaattcacctcaaagtgaggaatatgcgctgaaagttgaagacacaaatggtgta
tatgttgttcctgcttttgtaggattaggagccccttattgggatatgtatgcgagaggc
actattgtaggacttacaagaggcgcaaagagagagcatataataagggcaacactggag
tctattgcttatcagacaagagatgtattagaggctatgcaagaggattcaggtattaaa
ttgcaggctttaaaaattgacggtggagcaagtgctaataacttcttgatgcaattccaa
tctgacattttaggtgttccagttgacaggcctcaagtaattgaaactactgctcttggc
gcttcttatcttgcgggattggcagtaggattctggaacagcaaagaagaaatagagaag
aattggaatgttgataaacattttgaaccagctatggataatgaaaagagagaaaaattg
tataaaggttggaaaaaggctgtagaaagggctatgaaatgggctgaagaataa

DBGET integrated database retrieval system