KEGG   Thermoanaerobacter sp. X514: Teth514_1061Help
Entry
Teth514_1061      CDS       T00648                                 

Definition
(GenBank) putative glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tex  Thermoanaerobacter sp. X514
Pathway
tex00010  Glycolysis / Gluconeogenesis
tex00052  Galactose metabolism
tex00500  Starch and sucrose metabolism
tex00520  Amino sugar and nucleotide sugar metabolism
tex00521  Streptomycin biosynthesis
tex01100  Metabolic pathways
tex01110  Biosynthesis of secondary metabolites
tex01120  Microbial metabolism in diverse environments
tex01130  Biosynthesis of antibiotics
tex01200  Carbon metabolism
Module
tex_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tex00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Teth514_1061
   00052 Galactose metabolism
    Teth514_1061
   00500 Starch and sucrose metabolism
    Teth514_1061
   00520 Amino sugar and nucleotide sugar metabolism
    Teth514_1061
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Teth514_1061
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Teth514_1061
Enzymes [BR:tex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Teth514_1061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: ABY92360
UniProt: B0K684
Position
1098694..1099632
Genome map
AA seq 312 aa AA seqDB search
MRIGVDLGGTNIAVGLVDEEGRIVATGSRPTKPERGYEAVAKDIADIAIELIKRSNLSGS
DIKSMGIGVPGVADSERGIVIRAVNLFWTKVPLAKEIRKYIDLPIYMDNDANVAALAEAA
YGAGKGSKSSVTITLGTGVGSGFILDGKIYNGAHHFAPELGHIVIGDNGIRCNCGKIGCL
ETYASATALIREGKKAVEKNPNSLILKFANGDINSITAKNVIDAAKQYDEDAMRIFNDYV
KYLAIGIVNVINMFDPEVIILGGGVANAGDFLIKPLKKEVAENILFKDLPYADIRKAELG
NDAGIIGAAILS
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagaattggtgttgaccttggaggcactaatattgctgttggattggtggatgaagag
ggacgtatagtagctacaggtagcaggccgacaaaaccggaaaggggttatgaagcagtt
gccaaagacatagcggatatagctatagaacttattaagaggagtaatctaagtggaagt
gatattaagtcaatgggaataggagtcccgggtgtagcagatagcgaaagaggcatagta
atacgagcggtgaatctcttttggacaaaagttcctcttgcaaaagaaataagaaaatac
attgatttgccaatatatatggacaatgatgctaatgtagcagctttggcagaagcagca
tatggggctggcaaaggttctaagtcctcagtgacaattaccttaggaacaggagtaggt
tctggttttatccttgatggtaaaatatacaatggtgcacatcattttgcacctgagctt
ggacacatagtgataggagacaatggtataagatgtaactgtggtaaaattggatgttta
gagacatatgcttcagcaactgctttaataagagaagggaaaaaggcagtagagaagaat
cccaattctcttattttaaaatttgcaaatggagatataaacagcataacggctaaaaac
gtaattgatgctgcgaagcagtatgatgaagacgccatgaggatttttaatgactatgtc
aaatacttagctattgggattgtaaatgtgataaacatgtttgaccctgaagtgataata
ttgggtggcggagttgcaaatgcaggggattttctcataaaacctcttaaaaaagaagtg
gcagagaatattttattcaaagacttaccgtatgctgacataagaaaagcagagcttgga
aatgatgcagggatcatcggtgctgccatattaagttaa

DBGET integrated database retrieval system