KEGG   Thermoanaerobacter sp. X514: Teth514_1094Help
Entry
Teth514_1094      CDS       T00648                                 

Definition
glycoside hydrolase, clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
tex  Thermoanaerobacter sp. X514
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tex00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:tex00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:tex00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1131026..1133227
Genome map
AA seq 733 aa AA seqDB search
MSIHFNDKTKTFYLTAKDTSYVIYVLKNGAVLHAYFGKIIKTPNIYHLLKLPHISIDNDI
INFGNQLMLDFLPQEYPAYGNTDFRSPAYQIQLENGSTVSDLRYLSHKIYKGKPKLEGLP
ATYVENEDEADTLELELYDKVANLKVTLIYTAFRDYDVITRSVRFENMGKEDIKLLRALS
MNVDFNDSNFDMLQLSGAWARERHVIRRPLVPGAQSIESRRGASSHQQNPFIALLRNDAD
EWHGDVYGFSLVYSGNFLAQVEVDQYNMARVSMGINPFDFSWLLKPGETFQTPEVVMVYS
DGGLNKMSNTYHKLYRNRLMRSKFKDRETPILINNWEATYFDFTEEKLKELAKEAKDLGI
ELFVLDDGWFGKRNSDNSSLGDWFVNKEKIPSGLDGLAKGINSLGLKFGLWMEPEMVSPD
SDLYREHPDWCIHVPNRSRSESRNQLVLDLSRKDVQDYIIKVVSDILESANISYVKWDMN
RNMTEIGSALLPPERQRETAHRYILGLYRILEEITTRFPDVLFESCAGGGGRFDPGMLYY
MPQTWTSDDTDAIERLKIQYGTSIVYPLISMGSHISAVPNHQVHRITPLKIRAHVAMSAN
FGFELDLTKLSSEEKDEIKKYVEKYKEIRKLVQFGDFYRLLSPFEGNETAWLIVSEDKRE
FLLYYFRVLGGANEPIKRLRLKGINPDFNYVLEDDGSEYSGDELMYAGKVIPELKGDFQS
IMMHFKEESIKDG
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgtctattcattttaatgataaaacaaaaactttttacctaactgccaaagatacaagt
tatgtaatttatgttttaaaaaatggcgctgttttacatgcatattttggcaaaataata
aagactcctaatatataccatttattaaaattaccccatataagtatagataatgatatt
attaactttgggaatcagttaatgctagattttttgccacaggagtatcctgcgtatggt
aatactgattttaggagtcctgcatatcaaattcagcttgaaaacggttctactgtttct
gatctaaggtacttatctcacaaaatctataaaggtaagcctaaattagaagggcttccg
gctacttatgttgaaaatgaagatgaagctgatactcttgagttagaattgtatgataaa
gtagctaatttaaaggtaactttaatttatacagcatttagggattatgatgttataaca
aggtcagtgagatttgaaaacatgggaaaagaagacataaaattgttaagagctttgtct
atgaatgttgattttaatgatagtaattttgacatgcttcaattgtcaggagcttgggcg
agagaaagacatgttataagaagaccgcttgtaccaggagcccagtctattgaaagcaga
agaggtgcaagcagccatcagcaaaatccttttatagcacttttaaggaacgacgctgat
gaatggcatggagatgtgtatggatttagccttgtttacagtggcaatttcttggcacaa
gtagaagtagatcaatataatatggcaagagtttctatgggaatcaatccatttgatttt
tcatggcttctaaaaccaggtgaaacatttcaaacaccagaagtcgttatggtttattcg
gatggtggcttaaataaaatgtcaaatacctatcacaaactgtacagaaatagacttatg
agaagtaaatttaaggacagagaaacaccaattcttataaacaactgggaagctacttat
tttgattttacagaagaaaaacttaaagaacttgctaaagaagctaaagatttggggatt
gaactgtttgttcttgacgatggatggtttggaaagagaaattctgacaattcttcactg
ggagattggtttgtaaataaagaaaagattccaagtggtttggatggccttgcaaaaggg
ataaattctttaggtttaaaatttggattatggatggaaccagaaatggtgtctcctgat
agtgacctctatagagagcatcccgattggtgtatacatgtacctaataggtcgagaagt
gaaagcagaaatcaacttgtgttagacttgtcgcgcaaagatgtacaagattatattata
aaagtagtgtcagatattttggaaagcgccaacataagttatgtaaaatgggatatgaat
agaaatatgacagagataggctctgcacttttgcctcctgaaagacaaagagaaactgct
cacagatatatacttggactttacagaatattagaagaaataacgacaaggtttcctgat
gttttgtttgaaagttgtgctggtggtggtggtcgtttcgatccaggaatgctttattac
atgccacagacttggaccagtgatgatacagatgcaattgaaagacttaaaatacagtat
ggtacaagtatagtttatcctcttatttcaatgggaagccacatatccgctgtaccaaat
catcaagttcacagaattacgccgttaaaaatacgtgcacatgtagcaatgtcagctaat
tttggctttgaacttgatttgacaaaattgagcagtgaagaaaaagatgaaataaagaaa
tatgttgaaaagtataaagagattaggaaactggtgcaatttggagatttttatcgattg
ttaagtccctttgaagggaatgaaactgcttggttgattgtttctgaggataaaagagaa
tttttgctctattattttagagttttgggaggagcaaatgaacctattaaaagacttcgt
ctaaaagggataaatccagattttaattatgttttagaagatgatggtagtgaatatagt
ggtgatgaacttatgtatgcagggaaagtaattccagaacttaaaggggactttcagagc
attatgatgcattttaaggaggagagtattaaagatgggtag

DBGET integrated database retrieval system