KEGG   Thermoanaerobacter sp. X514: Teth514_1194Help
Entry
Teth514_1194      CDS       T00648                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tex  Thermoanaerobacter sp. X514
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:tex01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tex01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tex00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:tex00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tex00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tex00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:tex00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1231962..1232927
Genome map
AA seq 321 aa AA seqDB search
MKTIGILTSGGDAPGMNAAIRAVVRTGIYYGLKVKGIMRGYAGLVEDEVIDLNLSSVGDI
LQKGGTILRTARCEEFKKKEVRKKAYETLQKHGIEGLVVIGGDGSFRGAQLLSEEWNVNT
IGIPGTIDNDIPCTDYTIGFDTACNTVIDAINKIRDTATSHERANIIEVMGRNAGYIALY
AGLAGGAEMIILPEVEWSIDELCDKITYGIKRGKLHHIIVLAEGVMSAPELAKMIKERLP
KLDLRYTILGHIQRGGAPTVMDRVLASQMGARAVELLLENKTKRIISIRNNQIVDDDIDE
ALSMKKEFNRKLYELSKILSI
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgattggtatacttacaagtggtggagatgcaccagggatgaacgcagctata
agggctgtggtaaggacaggaatttattatgggcttaaagtaaaaggtattatgagggga
tatgcaggcttagtagaggatgaagttattgatttaaatctttcttcagtaggagatata
ttgcaaaaaggcggtactattttgagaactgctagatgtgaagaatttaagaaaaaagag
gtgcgcaaaaaagcttacgaaacccttcaaaaacatggaatagaaggtctcgttgtaatt
ggaggagatggctcttttagaggagcacagcttttgagtgaagaatggaatgtaaataca
attggaattccaggtacaattgacaatgacataccttgtacagattatacaataggtttt
gatacagcttgtaatactgttattgatgcaataaataaaataagggatactgctacttcc
catgagagagcaaatataatagaagtgatgggaagaaatgcgggttacattgctttgtat
gctggtctagctggtggagcggagatgattatacttcctgaagtggaatggagcatcgat
gaactttgcgataaaattacttacgggataaagagaggaaagcttcatcatataattgtc
cttgcagaaggagttatgagcgctccagaactagcgaaaatgattaaagaaaggctacca
aaattggacttaaggtatactattttggggcacattcaaagaggtggagctcctacagtg
atggatagggtattggcaagccaaatgggagcaagagcagtggagttgcttttagaaaat
aaaaccaagaggataataagtatacgaaacaatcaaattgtagacgatgatatagatgaa
gccctttccatgaaaaaggagtttaacagaaaactttatgagctcagcaagatattgtct
atataa

DBGET integrated database retrieval system