KEGG   Thermoanaerobacter sp. X514: Teth514_1308Help
Entry
Teth514_1308      CDS       T00648                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tex  Thermoanaerobacter sp. X514
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tex00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Teth514_1308 (tpiA)
   01230 Biosynthesis of amino acids
    Teth514_1308 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Teth514_1308 (tpiA)
   00051 Fructose and mannose metabolism
    Teth514_1308 (tpiA)
   00562 Inositol phosphate metabolism
    Teth514_1308 (tpiA)
Enzymes [BR:tex01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Teth514_1308 (tpiA)
Exosome [BR:tex04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Teth514_1308 (tpiA)
  Exosomal proteins of bladder cancer cells
   Teth514_1308 (tpiA)
  Exosomal proteins of melanoma cells
   Teth514_1308 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1345079..1345825
Genome map
AA seq 248 aa AA seqDB search
MRRPIIAGNWKMHMTPSEAVKLVDELIPQVKDAKAEVVVIPPFVDLTEVNKVIQGTNILL
GAQDMFWEEKGAYTGEISPLMLKEIGVKYVVIGHSERRQYFGETDEMVNKKVLSALSHGL
SPIVCVGESFSQREEGKTFEVVLSQTKEALKGVTHDDIVNVVIAYEPIWAIGTGKTATAK
DANEVIKAIRNTIASLYGKEKADLVRIQYGGSVKPENISELMAESDIDGALVGGASLVAS
DFAKIVNY
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
ttgagaagaccaataattgcaggtaattggaaaatgcacatgaccccttctgaagcggtg
aaattagttgatgaattgatacctcaagtgaaagacgcaaaagcagaagtggtagtcata
cctccctttgtggatttgacagaggtaaataaagtaattcaaggtactaatattcttctc
ggagcacaagatatgttttgggaagaaaagggcgcatatacgggggaaatttcaccttta
atgcttaaagagattggggtaaaatatgttgtaataggccactctgaaagaaggcagtat
tttggtgagacggatgaaatggtcaataaaaaagttttatccgctctatctcacggctta
agtcctattgtgtgtgtaggagaatctttttctcaaagagaagaaggaaaaacttttgaa
gtagttttaagtcaaactaaagaggctttaaaaggcgttacccacgatgatattgtaaat
gtagtaatagcttatgagccaatttgggctataggtactggcaaaacggctacagctaaa
gacgccaatgaagtgataaaagctataagaaatactatagcttccctttatggaaaagaa
aaagcagatctggttagaatacaatatggggggagtgtaaagcccgagaacatctctgaa
ctcatggcagagagcgatatagacggggctttagtggggggagcaagtcttgtagcatca
gattttgcaaagattgtcaattattaa

DBGET integrated database retrieval system