KEGG   Thermoanaerobacter sp. X514: Teth514_1308Help
Entry
Teth514_1308      CDS       T00648                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tex  Thermoanaerobacter sp. X514
Pathway
tex00010  Glycolysis / Gluconeogenesis
tex00051  Fructose and mannose metabolism
tex00562  Inositol phosphate metabolism
tex01100  Metabolic pathways
tex01110  Biosynthesis of secondary metabolites
tex01120  Microbial metabolism in diverse environments
tex01130  Biosynthesis of antibiotics
tex01200  Carbon metabolism
tex01230  Biosynthesis of amino acids
Module
tex_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tex_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tex00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Teth514_1308
   00051 Fructose and mannose metabolism
    Teth514_1308
   00562 Inositol phosphate metabolism
    Teth514_1308
Enzymes [BR:tex01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Teth514_1308
Exosome [BR:tex04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Teth514_1308
  Exosomal proteins of bladder cancer cells
   Teth514_1308
  Exosomal proteins of melanoma cells
   Teth514_1308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABY92600
UniProt: B0K6X4
Position
1345079..1345825
Genome map
AA seq 248 aa AA seqDB search
MRRPIIAGNWKMHMTPSEAVKLVDELIPQVKDAKAEVVVIPPFVDLTEVNKVIQGTNILL
GAQDMFWEEKGAYTGEISPLMLKEIGVKYVVIGHSERRQYFGETDEMVNKKVLSALSHGL
SPIVCVGESFSQREEGKTFEVVLSQTKEALKGVTHDDIVNVVIAYEPIWAIGTGKTATAK
DANEVIKAIRNTIASLYGKEKADLVRIQYGGSVKPENISELMAESDIDGALVGGASLVAS
DFAKIVNY
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
ttgagaagaccaataattgcaggtaattggaaaatgcacatgaccccttctgaagcggtg
aaattagttgatgaattgatacctcaagtgaaagacgcaaaagcagaagtggtagtcata
cctccctttgtggatttgacagaggtaaataaagtaattcaaggtactaatattcttctc
ggagcacaagatatgttttgggaagaaaagggcgcatatacgggggaaatttcaccttta
atgcttaaagagattggggtaaaatatgttgtaataggccactctgaaagaaggcagtat
tttggtgagacggatgaaatggtcaataaaaaagttttatccgctctatctcacggctta
agtcctattgtgtgtgtaggagaatctttttctcaaagagaagaaggaaaaacttttgaa
gtagttttaagtcaaactaaagaggctttaaaaggcgttacccacgatgatattgtaaat
gtagtaatagcttatgagccaatttgggctataggtactggcaaaacggctacagctaaa
gacgccaatgaagtgataaaagctataagaaatactatagcttccctttatggaaaagaa
aaagcagatctggttagaatacaatatggggggagtgtaaagcccgagaacatctctgaa
ctcatggcagagagcgatatagacggggctttagtggggggagcaagtcttgtagcatca
gattttgcaaagattgtcaattattaa

DBGET integrated database retrieval system