KEGG   Thermoanaerobacter sp. X514: Teth514_1581Help
Entry
Teth514_1581      CDS       T00648                                 

Definition
putative agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
tex  Thermoanaerobacter sp. X514
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tex00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Teth514_1581
Enzymes [BR:tex01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Teth514_1581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1600539..1601405
Genome map
AA seq 288 aa AA seqDB search
MIEGKYFVDPGKFLGATEDYEKAEVVILGLPMDYTVSFKAGSRFGPAAIRQASYGLEYYS
VYLDRRLEDKKFYDLGDLVLPYGNVKKSLDLISKATEDILKSGKKGLFLGGEHLVTYGIL
KEYLKKYGDNLVILHFDAHTDLREEFFGEAYSHATVMKKVWDIAKGIKMYNFGIRSGEKE
EFEFAEKNTHMFLYEVVEPLKGVIDDIKDYPIYISWDIDVVDPAFAPGTGTPEPGGITTK
EALEAIHILKDLNVVGMDLVEVSPSHDIAGITSILAAKLIRESILSFF
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaggaaaatattttgttgatccgggaaagtttttaggggctactgaagattat
gaaaaggcagaggtagttatactaggtttgcctatggattacacagtgagtttcaaagca
ggaagccgctttggacctgctgccataaggcaagcctcttatggtttagaatattatagt
gtgtatttagataggaggttggaagataagaaattttatgatttaggagatttagtactt
ccttatgggaatgtgaaaaagagtctagatttaatctcaaaagctacagaagacattttg
aaaagtggaaaaaaaggattgttcttgggtggagaacatttagtgacttatggaatttta
aaagagtacttaaaaaaatatggggataaccttgtaatccttcattttgatgcccatact
gatttaagagaagaatttttcggtgaagcttattctcacgccacagtaatgaaaaaagta
tgggatattgctaaaggtattaaaatgtataattttgggataaggtcaggtgaaaaagaa
gaatttgagtttgcagaaaaaaatacccacatgtttttgtatgaagtagttgaacctttg
aaaggtgtaattgatgatataaaagattatccaatttatattagctgggatatagatgtt
gtagaccctgcttttgcaccaggcactggtacaccagaaccagggggaataaccacaaaa
gaggcattagaggcaattcatattttaaaagatttaaatgtagttgggatggatttggtg
gaagtctcgccttctcacgatatagctggtataacctctattttagcagctaaacttata
agggaatctatcctttccttcttctaa

DBGET integrated database retrieval system