KEGG   Thermoanaerobacter sp. X514: Teth514_1863Help
Entry
Teth514_1863      CDS       T00648                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tex  Thermoanaerobacter sp. X514
Pathway
tex00260  Glycine, serine and threonine metabolism
tex00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tex01100  Metabolic pathways
tex01110  Biosynthesis of secondary metabolites
tex01130  Biosynthesis of antibiotics
tex01230  Biosynthesis of amino acids
Module
tex_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tex00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Teth514_1863
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Teth514_1863
Enzymes [BR:tex01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Teth514_1863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth BtpA
Motif
Other DBs
NCBI-ProteinID: ABY93143
UniProt: B0K2T8
Position
complement(1878621..1879409)
Genome map
AA seq 262 aa AA seqDB search
MNRIDKKFEVLKGEGRKALITFITAGDPDIETTYDIVLALEEAGSDIIELGIPYSDPLAD
GPTIQASSQRALNKGVKIPDIMKIVEKIRLKSDIPLVYLVYYNSIFKYGIQKFLKESKDV
GIDGLIIPDLPIEERKDILEEADKYGIYLIPLVAPTSKERIKLITENGKGFVYCVSITGV
TGAREDIETDIEEYMKTVSQYTNMPKAIGFGISTPEMAKKLKDFSDGIIVGSALVERIAK
GYNKSEMLQEVKSFVSSLKEVL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaataggattgacaaaaagtttgaagttttaaaaggagaagggcgcaaagccttaata
acctttataacagcgggagacccggatattgagacgacttatgatatagtcttggctttg
gaagaagcaggatctgatataatagaactgggaataccttattctgatcccttagctgat
ggacctacaatacaggcttcttcacaaagagctttaaataaaggtgtaaaaatacctgat
ataatgaaaatagtagaaaaaataaggttaaaaagtgatatccctctggtttaccttgtc
tactataactctatattcaaatatggcatacaaaaatttttaaaagagtcaaaagatgta
gggatagatgggcttatcataccagacttgcctattgaagaaagaaaagatattttagaa
gaagcagataaatacggtatttatttaatacctttagtcgctcccacatcaaaagaaaga
ataaaattaatcactgaaaatggcaaaggatttgtatattgtgtttcaattacaggtgtg
acaggagcaagagaagacattgaaactgacattgaagaatatatgaagacagtctctcaa
tacaccaatatgccaaaggcgatagggtttggcatatctactccggagatggcgaaaaaa
ttaaaagattttagtgatgggattattgtagggagtgcccttgtagaaagaattgctaaa
gggtataataaatctgaaatgctgcaggaagttaagagttttgtatccagcttaaaagaa
gtgttatga

DBGET integrated database retrieval system