KEGG   Thermoanaerobacter sp. X514: Teth514_1884Help
Entry
Teth514_1884      CDS       T00648                                 

Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
tex  Thermoanaerobacter sp. X514
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tex00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Teth514_1884
Enzymes [BR:tex01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Teth514_1884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1898468..1899109)
Genome map
AA seq 213 aa AA seqDB search
MQSEREQIVEYGKKLITSNLTKGTGGNLSIYNREKGLMAITPSGMDYFEIRPEDIVVMDL
DGKRIEGDRTPSSEYEMHRIFYANRQDINAIIHTHPVYSTTLACLNWDLPPVHYLVALAG
PNVRCAKYATFGTKELAENAFEAMKDRKAVLLANHGLLVGAEDLPNAFNISEQIEYVAEL
YYRAKSIGEPVILSEDEMKLMLEKFKTYGQVKK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcagaaagggaacaaatagtagaatatggtaaaaaactcataacctctaatctt
accaaaggtacaggtggaaacttaagtatttataatcgagaaaaaggattaatggctata
actccttctggaatggattattttgaaattcgaccggaagatattgttgtgatggattta
gatggcaaaaggatagaaggcgatagaactccttcctcggaatatgaaatgcatagaatt
ttttatgctaataggcaggatataaatgccattatacatacacatccagtgtattctact
actcttgcctgtttaaattgggaccttccaccagttcactatttagtagctttagctgga
ccaaatgtgagatgtgcgaaatatgcgacttttggtactaaagaattagcggaaaatgct
tttgaagcaatgaaggacagaaaagctgttttattagctaatcatggattactagtggga
gccgaagaccttccaaatgcttttaatataagtgaacagattgaatatgttgcggagttg
tactatagagcaaagtccataggagaaccggtaattctttctgaagatgagatgaaattg
atgttagaaaaatttaaaacttatggacaagttaaaaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system