KEGG   Thermoanaerobacter sp. X514: Teth514_2030Help
Entry
Teth514_2030      CDS       T00648                                 

Definition
dehydrogenase catalytic domain-containing protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tex  Thermoanaerobacter sp. X514
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:tex01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tex00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:tex00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tex00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2039473..2040621)
Genome map
AA seq 382 aa AA seqDB search
MPVNVVMPKLGLTMKEGRVDRWLKKVGDIVKKGEEIVEVSTDKITNVVESPADGILAKIL
VNEGEIVPVATPIGIITAEGEKLEEVEKSEEKFIKATPVAKRLAKENNIDLSLITGTGPG
GRITEEDVKKFISEQKVKTEEEGPKKEVAVIEGQALEKVERMPMDNIRKTISQRMKKSWS
EIPHVTEDIKVDVTELVNLRENLNHISDNKFTYTDLIAKACVIAIKKNPVVNWSIEGEYI
IKNSSINLGIAVALDNGLIVPVVKEADKKSLLELSKNIKELSERARNNKLTPDEIIGSTF
TITNLGMYEIDSFTPIINPPESAILGVNKIYKEPVVLDNNIVIRHIMKLSLSFDHRLIDG
ATAAKFLLDLKKTLENPVSLLI
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgccggtaaatgtagtgatgcctaaattgggacttacaatgaaagaaggcagagtagat
agatggcttaaaaaagttggtgatattgtaaaaaaaggagaagagattgtcgaggtttct
acagataagattaccaatgttgtagaatctccagcggatggaattttggcgaagatctta
gtaaatgaaggagaaattgtaccagtagctactcctattggaataattacagctgaaggg
gaaaagttagaagaagtagaaaaaagtgaggaaaagtttataaaagctactccagtagca
aaaaggttggcgaaggagaataacatagacctttctttaataactggaacaggaccaggt
ggaaggattactgaagaagacgtaaaaaagtttatttctgagcaaaaagtaaaaacagaa
gaagagggaccaaaaaaagaagtagcagtaatagaaggacaagcattggaaaaagttgaa
agaatgccaatggacaatattcgcaaaaccataagtcaaaggatgaaaaaaagctggtca
gaaattcctcatgttacagaagatattaaagtggatgtcacagaactggttaacttaaga
gaaaatttaaatcatattagcgataataaatttacttataccgatttaattgcaaaagca
tgtgtaatagctataaagaaaaatcctgtagttaactggtctatagaaggagaatatata
attaaaaatagcagtataaatctcggaattgcagtggctttagataatggtttaatagtt
cctgtagtgaaagaggcggacaaaaagagtctattagaattgtcaaaaaatataaaagaa
ttaagcgaaagagcgagaaataataagcttactccagacgaaataatcggaagtacattt
actatcactaaccttggaatgtatgaaatagatagtttcacgcctattataaatccgccc
gaaagtgctatattgggtgtcaacaaaatatataaagaaccagtagttcttgataacaat
attgttataaggcatatcatgaaacttagcctttcttttgaccatcgattaatagacggg
gctactgctgctaaatttctccttgacttaaagaaaacattagagaatccagtatcttta
cttatttaa

DBGET integrated database retrieval system