KEGG   Thermoanaerobacter sp. X514: Teth514_2237Help
Entry
Teth514_2237      CDS       T00648                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tex  Thermoanaerobacter sp. X514
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tex00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Teth514_2237
   00052 Galactose metabolism
    Teth514_2237
   00500 Starch and sucrose metabolism
    Teth514_2237
   00520 Amino sugar and nucleotide sugar metabolism
    Teth514_2237
Enzymes [BR:tex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Teth514_2237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2239235..2240143)
Genome map
AA seq 302 aa AA seqDB search
MKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAIQSGIEDILIITGRNK
RAIEDHFDKSVELELELKKKNKESLLNLVEDISNMVNIHYIRQKEPKGLGHAIYCAKSFV
GNEPFAVLLGDDIVDSEVPVLKQMIDQYERYNCSIIGVQEVPYEDVDKYGIVDAAIIEDR
LYKVKDLVEKPKKEKAPSNIAILGRYIITPRIFEILENTPPGAGGEIQLTDALKTLLNYE
AIYAYNFIGKRYDVGDKLGYLMATVEYALKREDLSEPFKRYLLELVDNLTAIEKEAAVTK
VK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaataagaaaggcgataattccggctgcaggccttggtacgaggtttttgcctgct
accaaggctcagcctaaagaaatgcttccaattgtggacaaacccactattcaatatata
gtcgaagaggcgattcaatcgggaattgaggatatccttataataactggcagaaataaa
agagcaatagaagaccattttgataaatctgtggagttggagctggagttaaaaaagaaa
aacaaggaaagtttacttaaccttgtagaggatattagcaatatggtgaacattcactat
ataaggcaaaaggaacctaaagggttgggacatgctatttactgtgctaaatcttttgta
ggaaatgagccttttgcagtacttttaggagatgacatagtagattcagaagtgccggtt
ttaaagcagatgattgaccaatacgaaaggtacaactgttctattattggggtacaagag
gtgccgtatgaggatgtagataaatatggaatagttgacgctgctattattgaggataga
ttatacaaagtcaaagaccttgtggaaaagcctaaaaaagaaaaggcgccttctaacatc
gctattttgggaagatatataattacaccaagaatatttgaaatattggaaaacacgcca
ccaggagcaggaggtgaaatacagcttacagatgctttaaaaactctcttaaattatgaa
gcaatttacgcctataattttattggcaagagatatgatgtgggagataaattaggttac
cttatggcaactgttgagtatgctctaaaaagagaggacttaagtgaaccttttaagagg
tatttattagaacttgttgacaatttaacagctatcgaaaaggaggctgcggttacaaaa
gtaaaatag

DBGET integrated database retrieval system