KEGG   Thermoanaerobacter sp. X514: Teth514_2238Help
Entry
Teth514_2238      CDS       T00648                                 

Definition
(GenBank) Phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
tex  Thermoanaerobacter sp. X514
Pathway
tex00010  Glycolysis / Gluconeogenesis
tex00030  Pentose phosphate pathway
tex00051  Fructose and mannose metabolism
tex00052  Galactose metabolism
tex00230  Purine metabolism
tex00500  Starch and sucrose metabolism
tex00520  Amino sugar and nucleotide sugar metabolism
tex00521  Streptomycin biosynthesis
tex01100  Metabolic pathways
tex01110  Biosynthesis of secondary metabolites
tex01120  Microbial metabolism in diverse environments
tex01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tex00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Teth514_2238
   00030 Pentose phosphate pathway
    Teth514_2238
   00051 Fructose and mannose metabolism
    Teth514_2238
   00052 Galactose metabolism
    Teth514_2238
   00500 Starch and sucrose metabolism
    Teth514_2238
   00520 Amino sugar and nucleotide sugar metabolism
    Teth514_2238
  Nucleotide metabolism
   00230 Purine metabolism
    Teth514_2238
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Teth514_2238
Enzymes [BR:tex01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Teth514_2238
    5.4.2.8  phosphomannomutase
     Teth514_2238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV DUF2218 CCB1
Motif
Other DBs
NCBI-ProteinID: ABY93507
UniProt: B0K4N4
Position
complement(2240174..2241541)
Genome map
AA seq 455 aa AA seqDB search
MKLNENMFRMYDIRGVWEDDLTVESAELIGKAFGTYVRQKGIKDVLVGRDNRLSSRPIRD
ALIKGLTSTGCDVLDVGVLTTPAFYYSNVLYNYQAGMMITASHNPPQFNGFKVMVGPSTI
YGDELKKLYYIAEKGEFEEGTGNVKYAYPINSYINMIKEKVKLGDRKLKVVVDCGNGTGS
YFYPDVIYNLGCEVYPLYCESDPTFPNHFPDPVKEENLKDLIEEVKRVNADLGIAFDGDG
DRIGVVDDKGNVIWGDMLMILYWREIMKKHPGADAIVEVKCSQALVEEIERLGGKPIFFK
TGHSLIKAKMKELGAVFTGEMSGHMFFADEYYGFDDAAYAAARLLRILSNTDKSLSELLA
DVPKYPATPEIRLECDDEKKFDVVKGVTEYFKEKGYNIIDVDGARVLFDGGWGLVRASNT
GPELIVRCEAKTEEKLEAIKKELSEALAKFSVEFK
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgaatgaaaatatgtttaggatgtatgatattagaggcgtatgggaagatgat
ttgactgttgaaagtgctgagcttatagggaaggcctttggtacatatgtgagacaaaaa
ggaattaaggatgtgctggtaggcagagataatagattatcatcaagacctatacgagat
gctttgattaaaggacttacttctacaggctgtgatgtattagatgtaggggttttgacg
actccagctttttactattctaatgtcctgtacaattatcaagcagggatgatgattact
gcaagccacaatccgccacaatttaatggtttcaaagttatggtaggaccttctacaatt
tatggcgatgaacttaaaaaactttactatatagcagaaaaaggcgaatttgaagaaggt
acaggaaatgtgaagtatgcttatccaattaattcgtatattaatatgataaaagaaaag
gttaaattaggcgacagaaagcttaaagttgttgtcgattgtgggaatggcacaggttca
tatttttatcctgatgtgatatacaatttaggttgtgaagtatatcctctctattgtgaa
tctgatcctacatttccaaaccattttccagatccagtaaaagaagaaaatttaaaagat
ttaattgaagaagtaaagagggtaaacgcagatttgggtatagcttttgacggtgacggt
gatagaatcggcgtcgtagatgataaaggcaatgtaatttggggagatatgttgatgatt
ctttattggagagaaataatgaaaaaacatcccggcgctgatgccattgtagaagtgaaa
tgttctcaggcattagtagaagaaattgagagattgggaggcaaacctatcttcttcaaa
acagggcattccctcataaaagcaaaaatgaaagaattaggtgctgtgtttacaggagaa
atgtctggtcatatgttttttgcagatgagtactatgggtttgatgatgcggcatacgct
gctgcaaggcttttacgaatactttctaatacagataaatctttgtctgagcttttagct
gatgttcctaaatatcctgcaacacctgaaataaggttagaatgtgacgatgagaaaaaa
tttgatgtggtaaaaggtgtaactgaatactttaaagaaaaaggatacaacattatagat
gttgatggtgcaagagtgttgtttgatggaggatggggactggttagagcttctaacaca
ggaccagagcttattgtgagatgtgaggcaaagacagaagaaaaacttgaagcgattaaa
aaagagctttcagaagctttagctaaatttagcgtagagtttaaataa

DBGET integrated database retrieval system