KEGG   Thermoanaerobacter sp. X514: Teth514_2310Help
Entry
Teth514_2310      CDS       T00648                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tex  Thermoanaerobacter sp. X514
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tex00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Teth514_2310
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Teth514_2310
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Teth514_2310
Enzymes [BR:tex01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Teth514_2310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
complement(2330199..2331254)
Genome map
AA seq 351 aa AA seqDB search
MGWEGLIKAYREFMPKIKEENIVTLKEGNTPLYEAVNLQKLFPGIKIYLKYEGLNPTGSF
KDRGMTVAVSQAKEEGSNAVVCASTGNTSASAAAYAAKAGLKSIVLIPGGKIALGKLAQA
IAYGAKVIAIDGNFDDALRLVREISQKFPITLVNSINPYRLEGQKTASFEICDELKDAPS
YVALPVGNAGNITAYWMGFKEYYNAKRITRLPKMLGFQAAGAAPIVENRVIEKPETIATA
IRIGNPASWEKAVAARDESGGLIDKVTDEEILEAYALLAKSEGIFAEPASAASIAGVIKK
YKEGFFKEGESVVCVLTGNGLKDPDTAVKLGGEIKTIEANLKALEEVLYGE
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggatgggaaggtctaataaaagcttatagagaatttatgcctaaaataaaagaggaa
aacatagttacattaaaagaaggcaatacacctctttatgaggctgtaaatcttcaaaag
ctttttccaggcataaaaatatatctgaaatacgaaggattaaacccaacaggttctttt
aaagacagggggatgactgtagcagtgtcgcaggcaaaagaagaaggttctaatgcagtt
gtgtgtgcttcaacaggaaacacttctgcttctgcagctgcctatgcagcaaaggcagga
cttaagagcattgtacttatacccggcggcaaaattgctttaggaaagcttgctcaagcc
attgcttatggtgctaaagtcattgctatagatggaaactttgatgatgctttaagatta
gtcagagaaatttcacaaaaattccctataacgctggttaattccataaatccatatagg
ttggaaggacaaaagacagcttcttttgaaatatgtgacgaacttaaagatgctccttct
tatgttgcgcttcctgtgggaaatgcggggaatataacagcctattggatgggatttaaa
gaatattataatgcaaaaagaataacgaggcttcctaaaatgttaggttttcaggcagct
ggagctgcacctatagttgaaaacagagtaattgaaaaacctgagactattgcaacagcg
atacgaataggtaatccagccagctgggaaaaggcagttgctgcaagagatgagtcaggt
ggactcattgacaaagtcacagatgaagaaatactggaggcttatgcgcttttagctaag
agcgaaggaatttttgcagagcctgcttcagcagcttctattgcaggagttattaaaaaa
tacaaggaaggattttttaaagaaggagaatctgttgtttgtgtcttgacgggaaatgga
ttaaaagatccagatactgctgttaaattaggtggcgagataaaaacgatagaggcgaat
ctaaaagcattggaggaagttttatatggagagtga

DBGET integrated database retrieval system