KEGG   Tannerella forsythia: BFO_0306Help
Entry
BFO_0306          CDS       T01682                                 

Gene name
fucI
Definition
arabinose isomerase
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
tfo  Tannerella forsythia
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tfo00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BFO_0306 (fucI)
Enzymes [BR:tfo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     BFO_0306 (fucI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
326777..328570
Genome map
AA seq 597 aa AA seqDB search
MGEHRFQGEWPKIGIRPTIDGRMGGVRESLEKQTMDMAKSVVKLLTKTLQYPDGTPVACV
IADSTIGRVAESAACTEKFRRENVAVTITVTPCWCYGSETMDMDPHTVKAVWGFNGTERP
GAVYLAAVLAAHAQKGLPAFGIYGHEVQDADAKDIPADVRDKLLRFARAAMAVALMRGKS
YLSIGAVCMGIAGSIVDSNFFENYLGMRCEGVDEVEIIRRMENDIYDKEEYKKALAWAKK
NCKQGEDIINRKDLAKTKAEHEKDWEFTVKMTLIVRDLMVGNPKLKSLGFGEEALGHHAI
VAGFQGQRQWTDFYPNGDFTEAILNSSYDWSGIRAPFILATENDSLNGAAMLFGHLLTNT
AQIFADVRTYWSPEAVLRVTGKKLTGKAAQGIIHLINSGAATLDGSGQQSDKKGKPVMKP
FWEITKDEAQACLDATTWMPANREYFRGGGYSSKFLTKGGMPCTMMRLNIVKGLGPVLQL
AEGWTVDLDEKSFRILDDRTDKGWPTTWFAPRLTGKGPFKDVYSVMNNWGANHGAISFGH
IGADLITMASMLRIPVCMHNVEEDDIFRPASWNAFGMDKEGADYRACSSYGPLYGKY
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgggagaacatagattccaaggcgaatggccgaagatcgggattcgtccgacgattgac
ggacgaatgggaggagtgcgcgaatcactcgaaaaacagacaatggatatggcgaaaagt
gtcgtaaaactactgacaaagacgctgcaataccccgacggcacaccggttgcgtgtgtg
atcgccgattcaaccatcggacgggtggccgagagcgccgcatgcaccgaaaagttcaga
cgcgagaacgtggcggtgacgattaccgtcaccccctgctggtgctacggaagcgaaacg
atggacatggacccgcacacggtgaaagctgtctggggatttaatgggaccgaacgtccg
ggagccgtttacctggcagccgtattggcagctcacgcgcaaaaaggactgccggccttc
ggcatctacggacatgaagtgcaggatgctgatgcgaaagacatcccggccgatgtgcgc
gacaaactgttgcgttttgcacgtgcagcgatggcggtcgctctgatgcgcggcaaatcg
tacctgtcgatcggtgccgtatgtatgggaattgccggttcgatcgtcgattcgaatttc
ttcgagaattacctcggtatgcgttgcgaaggagtcgatgaggtcgaaatcatccgtcgc
atggagaacgatatttacgataaagaagaatataaaaaagcgttggcgtgggcaaagaaa
aattgcaagcaaggcgaagatatcattaaccgcaaagacttggcaaagacgaaagccgag
cacgaaaaagattgggagtttactgttaagatgaccctgatcgtgcgcgacctgatggtg
ggtaatcccaaactcaaatcgctcggattcggtgaagaagccctcggacatcacgcaatt
gttgcaggttttcaagggcagcgccaatggacggacttctatccgaacggagactttacg
gaggcgatcctcaactcgtcatacgactggagcggtatccgcgcgccattcattctggcc
accgagaacgactcgctcaacggagcagccatgctgttcggccatttgctgacgaatacg
gcgcaaatctttgccgacgtcagaacgtactggagtcccgaagccgtactgcgtgtaacc
ggtaaaaagctgaccggcaaagcggcacagggaatcatccacctgatcaattccggagcg
gcgaccctcgacggctccggccagcagagcgacaagaaaggaaagccggtgatgaaaccg
ttctgggagatcacaaaagacgaagcacaggcttgcctcgacgctacgacttggatgcct
gctaatcgcgaatatttccgcggtgggggctattcctcgaaattcctgaccaaaggagga
atgccgtgcacgatgatgcgcttgaacatcgtcaaaggccttggccccgtactgcaactg
gccgaaggatggacggtagacctcgacgagaaatcattccgaatcctcgatgatcgtacc
gacaagggttggccgacgacgtggttcgcaccgcgactcaccggcaaaggcccgttcaag
gacgtctattcggtcatgaacaactggggagccaaccacggagccatcagcttcggacat
atcggcgccgacctgatcacgatggcctcaatgttgcggatccccgtttgtatgcacaac
gtggaagaagacgatatcttccggccggcttcatggaacgccttcggtatggataaggaa
ggagcggactatcgcgcctgcagctcttacggtccgctctacgggaaatattga

DBGET integrated database retrieval system