KEGG   Tannerella forsythia: BFO_0306Help
Entry
BFO_0306          CDS       T01682                                 

Gene name
fucI
Definition
arabinose isomerase
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
tfo  Tannerella forsythia
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tfo00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
326777..328570
Genome map
AA seq 597 aa AA seqDB search
MGEHRFQGEWPKIGIRPTIDGRMGGVRESLEKQTMDMAKSVVKLLTKTLQYPDGTPVACV
IADSTIGRVAESAACTEKFRRENVAVTITVTPCWCYGSETMDMDPHTVKAVWGFNGTERP
GAVYLAAVLAAHAQKGLPAFGIYGHEVQDADAKDIPADVRDKLLRFARAAMAVALMRGKS
YLSIGAVCMGIAGSIVDSNFFENYLGMRCEGVDEVEIIRRMENDIYDKEEYKKALAWAKK
NCKQGEDIINRKDLAKTKAEHEKDWEFTVKMTLIVRDLMVGNPKLKSLGFGEEALGHHAI
VAGFQGQRQWTDFYPNGDFTEAILNSSYDWSGIRAPFILATENDSLNGAAMLFGHLLTNT
AQIFADVRTYWSPEAVLRVTGKKLTGKAAQGIIHLINSGAATLDGSGQQSDKKGKPVMKP
FWEITKDEAQACLDATTWMPANREYFRGGGYSSKFLTKGGMPCTMMRLNIVKGLGPVLQL
AEGWTVDLDEKSFRILDDRTDKGWPTTWFAPRLTGKGPFKDVYSVMNNWGANHGAISFGH
IGADLITMASMLRIPVCMHNVEEDDIFRPASWNAFGMDKEGADYRACSSYGPLYGKY
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgggagaacatagattccaaggcgaatggccgaagatcgggattcgtccgacgattgac
ggacgaatgggaggagtgcgcgaatcactcgaaaaacagacaatggatatggcgaaaagt
gtcgtaaaactactgacaaagacgctgcaataccccgacggcacaccggttgcgtgtgtg
atcgccgattcaaccatcggacgggtggccgagagcgccgcatgcaccgaaaagttcaga
cgcgagaacgtggcggtgacgattaccgtcaccccctgctggtgctacggaagcgaaacg
atggacatggacccgcacacggtgaaagctgtctggggatttaatgggaccgaacgtccg
ggagccgtttacctggcagccgtattggcagctcacgcgcaaaaaggactgccggccttc
ggcatctacggacatgaagtgcaggatgctgatgcgaaagacatcccggccgatgtgcgc
gacaaactgttgcgttttgcacgtgcagcgatggcggtcgctctgatgcgcggcaaatcg
tacctgtcgatcggtgccgtatgtatgggaattgccggttcgatcgtcgattcgaatttc
ttcgagaattacctcggtatgcgttgcgaaggagtcgatgaggtcgaaatcatccgtcgc
atggagaacgatatttacgataaagaagaatataaaaaagcgttggcgtgggcaaagaaa
aattgcaagcaaggcgaagatatcattaaccgcaaagacttggcaaagacgaaagccgag
cacgaaaaagattgggagtttactgttaagatgaccctgatcgtgcgcgacctgatggtg
ggtaatcccaaactcaaatcgctcggattcggtgaagaagccctcggacatcacgcaatt
gttgcaggttttcaagggcagcgccaatggacggacttctatccgaacggagactttacg
gaggcgatcctcaactcgtcatacgactggagcggtatccgcgcgccattcattctggcc
accgagaacgactcgctcaacggagcagccatgctgttcggccatttgctgacgaatacg
gcgcaaatctttgccgacgtcagaacgtactggagtcccgaagccgtactgcgtgtaacc
ggtaaaaagctgaccggcaaagcggcacagggaatcatccacctgatcaattccggagcg
gcgaccctcgacggctccggccagcagagcgacaagaaaggaaagccggtgatgaaaccg
ttctgggagatcacaaaagacgaagcacaggcttgcctcgacgctacgacttggatgcct
gctaatcgcgaatatttccgcggtgggggctattcctcgaaattcctgaccaaaggagga
atgccgtgcacgatgatgcgcttgaacatcgtcaaaggccttggccccgtactgcaactg
gccgaaggatggacggtagacctcgacgagaaatcattccgaatcctcgatgatcgtacc
gacaagggttggccgacgacgtggttcgcaccgcgactcaccggcaaaggcccgttcaag
gacgtctattcggtcatgaacaactggggagccaaccacggagccatcagcttcggacat
atcggcgccgacctgatcacgatggcctcaatgttgcggatccccgtttgtatgcacaac
gtggaagaagacgatatcttccggccggcttcatggaacgccttcggtatggataaggaa
ggagcggactatcgcgcctgcagctcttacggtccgctctacgggaaatattga

DBGET integrated database retrieval system