KEGG   Tannerella forsythia: BFO_0610Help
Entry
BFO_0610          CDS       T01682                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
tfo  Tannerella forsythia
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:tfo00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(662835..663401)
Genome map
AA seq 188 aa AA seqDB search
MKGKLIIFSAPSGSGKSTIIRYLLDKGLPLRFSISATSRAPRGEEQDGREYYFLTPDTFR
QKIAAGEFLEYEEVYRDQFYGTLRSEIERIQASGNTVVLDVDVVGGCRIKEQYGAEALSV
FIRPPSIDALRTRLEKRGTDAPEVIERRLEKATYELSFASRFDRIIVNDDLEQAQREALK
TVTDFIHS
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgaagggtaaactgattattttttcggctccgtcggggtcaggtaaatctacgattatt
cgttatttattggataaaggcttgcctcttcgcttctcgatctccgctacgagccgtgct
ccgcgaggcgaagagcaggatggcagagaatattattttttgacaccggacacattcagg
cagaaaatcgcggcaggggaatttctcgaatacgaagaagtctaccgagatcaattctat
ggtacactccggtcggaaatagagcgtattcaagcgagcggtaatactgtcgtactcgat
gtcgatgtggtgggaggctgccgtatcaaagagcaatatggagctgaagccctgtctgtt
tttatccgccctccgtcgatcgacgcattgcgtacccggctcgaaaagagaggcacggat
gctcccgaagtcattgaacgtcggctggaaaaagcaacgtatgagctctcgtttgcttcc
cgattcgaccgaatcattgtgaatgatgatttggagcaggcacagcgggaagcgttgaaa
acggtgaccgattttattcactcctga

DBGET integrated database retrieval system