KEGG   Tannerella forsythia: BFO_0802Help
Entry
BFO_0802          CDS       T01682                                 

Definition
pyridoxal-phosphate dependent TrpB-like protein
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tfo  Tannerella forsythia
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tfo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BFO_0802
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BFO_0802
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BFO_0802
Enzymes [BR:tfo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BFO_0802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
875473..876834
Genome map
AA seq 453 aa AA seqDB search
MNPKKFLLQEKDIPTAWYNIVADMKTKPMPMLNPATRQPMTAEDLYPLFATGLAQQELNV
TDTWIEIPEEVCDLYKNWRPTPLVRAYGLERALDTPAHIYFKNESVSPIGSHKLNSALAQ
AYFCRKDGVTNITTETGAGQWGAAMSYAAKAFGLELAVYMVKISYNQKPYRRSMMQTFGA
QVIASPSMSTKSGRKILTDHPTYQGSLGTAISEAVELAMQTPNCKYVLGSVLNHVALHQT
VIGLEAEKQMEMAGEYPDVVIACFGGGSNFSGLSFPFLRHKLTEGRTLRVVAAEPASCPK
LTRGRFQYDFGDEAGHTPLIPMYTLGHTFSPAHIHAGGLRYHGAGAIVSQLKKEGLMNAV
DIPQLETFDAARLFAKTEGIIPAPESAHAIAATIREAKEAKEEGKARTILFNLSGHGLID
MAAYDLYLAGDLTNYELPDEELKKSTQDLEQII
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgaagaagtttttattacaagagaaagatattcccactgcatggtataatatc
gtagccgatatgaagacaaagccgatgcccatgctcaatccggctactcggcagccgatg
acggccgaggatctctacccgctcttcgccaccgggttggcacaacaggagttgaacgtg
acggacacatggatcgaaatccccgaggaggtgtgcgacctctacaagaactggcgcccc
acgccgctcgtccgggcctacggtctggagcgcgcattggatactccggcacatatttat
ttcaagaatgagagtgtcagccccatcggttcgcacaagctcaactcggcgctcgcacaa
gcttatttctgccggaaagatggggtgacgaacatcaccaccgagacgggcgctggacaa
tggggcgcggcaatgtcgtatgcggccaaggctttcgggttggagttggccgtctatatg
gtcaagatcagttataatcagaagccctaccgtcgttcgatgatgcagacattcggggca
caggtcatcgcttcgccgagcatgagtacgaagtcgggaaggaagatattgacggatcac
ccgacgtatcagggcagcctcggcacggcgatttccgaagccgtggagctggccatgcag
acacctaactgcaagtacgtgttgggcagtgtgctcaaccatgtggcgctccaccagacg
gtgatcggtctggaggcggagaagcagatggagatggcgggcgaatatccggatgtggtg
atcgcgtgcttcggcggagggtccaatttctccggcctgtcgttccccttcctaaggcat
aagctgaccgagggtcgcacgctacgtgtcgtggcggccgaaccggcatcatgcccgaag
ctgacgcgtggccgcttccaatacgacttcggcgacgaagcgggtcacacaccgctcatt
cctatgtatacgctcggccacacgttctccccggcacatatccacgccggcggactgcgt
taccacggtgccggagccattgtcagtcaactgaagaaggaggggctgatgaacgccgtc
gacatcccgcagcttgagacgttcgacgccgcccgactcttcgccaagacggagggtatc
atccccgcacccgagtcggctcacgctatcgccgctacgatccgggaagcgaaggaggcg
aaggaggaaggcaaagcacgcacgatcctcttcaacctttcgggccacggactgatcgat
atggctgcctatgacctgtatctggccggcgacctgaccaactacgaacttcccgacgag
gaactgaagaaatcaacccaagatctggaacagattatttaa

DBGET integrated database retrieval system