KEGG   Tannerella forsythia: BFO_0816Help
Entry
BFO_0816          CDS       T01682                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
tfo  Tannerella forsythia
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tfo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BFO_0816
Enzymes [BR:tfo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BFO_0816
Exosome [BR:tfo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BFO_0816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(897407..899509)
Genome map
AA seq 700 aa AA seqDB search
MEKLTLIQNDPWLKPYSDAIEGRYHRTIEKEKTLTCGGKQTLAEFASGYLYFGLHRTEDG
WVFREWAPHATAIYLIGTFNGWEKNESYRLKPLDNGNWEIVLPAAALHHEDLYKLLIEWE
GGCGERIPAWCRRVVQDEQTKIFSAQVWAPENPYQFEVKTFRPDTSPLLIYECHIGMASE
EEKTGTYEEFRTHVLPRIVKDGYNAIQIMAIQEHPYYGSFGYHVSSFFAPSSRFGTPDEL
KCLIDDAHRMGLTVIMDIVHSHAVKNETEGLGRFDGSYHQYFHTGTRREHQAWDSLCFDY
GKDEVLHFLLSNCKYWLDEYRFDGFRFDGVTSMLYYSHGLGEDFLSYGDYYNGHQDDDAI
TYLTLANKLIHEVNPHAVTIAEEVSGMPGLAVKVADGGYGFDYRMAMNIPDFWIKILKEK
KDEDWHPSAIWWETTNRRADEKTISYAESHDQALVGDKTIIFRLIDADMYWHMQADDRHF
MVERGLALHKMIRLVTATTINGGYLNFMGNEFGHPEWIDFPREGNGWSYKYARRQWSLVD
APNLKYRFLGDFDREMLALIRSVKDFQALPVQKVWDNDGDQVLAYMRGEYVFVFNFSPAQ
SFTDYGLLTPPGTYRTVLNTDDPRFGGNGLTDDAIEHLTQYDPLYEKEYKGWLKLYLPAR
TAMVLKRLPEVRSLSVEQGEMEKRRVRKKRCHAKGKNNVM
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaattgactctaattcagaatgatccttggctgaaaccttattcggacgctatc
gaaggacgttatcaccgtacgatagaaaaagagaaaacattaacctgtggcgggaaacaa
acccttgccgaattcgcatcgggttatctgtatttcggattgcaccggacggaggatgga
tgggtgttccgcgaatgggcgccgcatgccacagctatctatctgatagggacgttcaac
ggctgggaaaagaacgagagttatcgtctgaaacctctcgacaacggcaactgggagatc
gttttgccggctgctgccctccatcacgaagatttatacaagttactcatcgaatgggaa
gggggctgcggagagcgtatccctgcatggtgccgtcgggtggtgcaggacgagcagacc
aaaatcttctccgcgcaagtctgggcgcctgaaaatccgtatcagtttgaagtaaagaca
ttccggccggatacgtcgccactgctgatttacgagtgccatatcggtatggcttcagaa
gaggagaagacaggtacgtatgaggaattccgtacacacgttctgccgcgtatcgtgaag
gacggctataatgccatacagatcatggcgatacaggagcatccgtattacggttcattc
gggtatcatgtgagcagtttttttgcgccctcatcacgcttcggcacgcccgacgagttg
aagtgtctcatcgacgatgcccatcgaatggggctgacggtgatcatggatattgtgcac
agtcatgccgtgaaaaatgaaacagaggggctcggacgtttcgacggttcgtatcatcag
tatttccataccggtacccggcgtgaacatcaggcatgggactctctctgcttcgattac
ggaaaggacgaggtgttgcattttctgctgtcgaactgcaaatactggctggatgagtat
cgcttcgacggttttcgtttcgatggtgtcacctcgatgctttattacagccatggactg
ggcgaagatttcttaagctacggtgactattacaacggtcatcaggacgatgacgcgata
acatacctgacgctggctaacaaactgatacacgaggttaatccgcatgccgtgacgatt
gcggaggaagtcagcggtatgccggggctggcggttaaagtagccgatggtggctatggg
ttcgattaccgcatggcgatgaatatcccggatttctggatcaaaatactgaaagagaag
aaagatgaagactggcatccttcggccatctggtgggagacaacgaatcggcgggccgat
gagaagaccatcagctatgccgagagtcacgatcaggcgttggtaggagataaaacgatc
atcttccgtcttatcgatgccgatatgtactggcacatgcaggcggacgaccgacacttt
atggtagagcgcggactggcgcttcataaaatgatccggctcgtgacggccacgacgatc
aacggcggttatctgaattttatggggaacgagttcggacatcccgaatggatcgatttc
ccgcgcgaaggcaacggctggtcgtacaagtatgctcgccgacagtggagtctggtcgat
gctccgaacctgaaatatcgctttctgggcgattttgaccgtgagatgcttgcgttgatc
cgcagcgtaaaagattttcaagcgctacccgtgcagaaggtgtgggataacgacggcgac
caggtgctggcctacatgcgtggagaatatgtgttcgtctttaatttcagtcctgcgcag
tcgtttaccgattatggtctcctgactcctccgggcacttaccgtacagtactaaatacg
gatgacccgcgtttcggagggaacggattaaccgacgatgccatcgagcatctgacgcaa
tacgatccgctttacgaaaaagaatataaaggctggctgaaactgtatctcccggcgcgc
acggctatggtattgaaacggctacctgaagttcgttcattatcggtcgaacaaggagag
atggagaaaagacgggtacggaaaaaacgatgccacgcaaaaggaaagaataacgtcatg
taa

DBGET integrated database retrieval system