KEGG   Tannerella forsythia: BFO_0991Help
Entry
BFO_0991          CDS       T01682                                 

Definition
(GenBank) putative glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tfo  Tannerella forsythia
Pathway
tfo00010  Glycolysis / Gluconeogenesis
tfo00052  Galactose metabolism
tfo00500  Starch and sucrose metabolism
tfo00520  Amino sugar and nucleotide sugar metabolism
tfo00521  Streptomycin biosynthesis
tfo01100  Metabolic pathways
tfo01110  Biosynthesis of secondary metabolites
tfo01120  Microbial metabolism in diverse environments
tfo01130  Biosynthesis of antibiotics
tfo01200  Carbon metabolism
Module
tfo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tfo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BFO_0991
   00052 Galactose metabolism
    BFO_0991
   00500 Starch and sucrose metabolism
    BFO_0991
   00520 Amino sugar and nucleotide sugar metabolism
    BFO_0991
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BFO_0991
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BFO_0991
Enzymes [BR:tfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BFO_0991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FGGY_N DUF460 RuvC DEDD_Tnp_IS110
Motif
Other DBs
NCBI-ProteinID: AEW22621
UniProt: G8UQ20
Position
1074415..1075386
Genome map
AA seq 323 aa AA seqDB search
MEKPYVIGIDIGGTNTVFGVVDARGTILYSGSIKTGHYDDINDYVKALGDGLQNVINSAG
GKDKIKGIGVGAPNGNYFNGCIEFAPNLPWKGKIPLAQMISDQTGGIPVTLTNDANAAAI
GEMTYGAARGLKDFIVITLGTGVGSGIVIGGNLVYGHDGFAGELGHVIVRRENGRLCGCG
RHGCLEAYASATGVARTACELLMTRTEESLLRELEPDKITSKDVYDAAVKGDKLSQEIFE
TTGAILGEAFADFVAFSSPEAIILFGGLTKAGQLLMEPVKRSMEAHMLKVFQNKTRLLFS
QLKESDAAVLGASALGWEVKEEL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggagaagccttatgtaattggaattgatatagggggtacgaataccgtattcggcgta
gtagatgcccgaggaaccattttgtatagcggttcgattaagacagggcattatgatgac
attaacgactatgtaaaagcccttggcgacgggttacagaatgtgatcaactcggccgga
ggcaaagacaagatcaaaggcatcggggtaggagcgcctaacggcaactatttcaacggt
tgcattgaatttgcacccaacttaccgtggaaaggaaaaattcctttggcacagatgatc
agcgatcagacgggaggcattccggtcactttgacaaacgacgccaatgcggcggctatc
ggtgagatgacgtatggtgcggctcgcggtttgaaagattttatcgtcatcacactgggt
acaggcgtgggcagcggaatcgtcatcggcggcaatctggtatacggtcacgacgggttt
gccggtgagttgggacacgtgatcgtgcgccgcgagaacgggcgtctgtgcggatgcggc
cgtcacgggtgtttagaggcctatgcttcggccacaggtgtagcccgtacggcttgcgaa
ctgctgatgacacgtaccgaagagagcctgttacgtgagttggaaccggacaaaatcacc
tcaaaagatgtgtatgatgcggctgttaaaggcgacaaactctcccaagaaatcttcgaa
acaaccggagcaattttaggggaagcctttgccgacttcgtggctttctcaagcccggaa
gcaatcattcttttcggcggcctgacgaaagcgggacagcttcttatggagccggtgaaa
cgctctatggaagctcatatgctgaaggtattccaaaacaagacccgtctgctgttctca
cagctgaaagaaagcgatgccgccgtattaggcgccagcgcactcggctgggaagtgaaa
gaagagctatag

DBGET integrated database retrieval system