KEGG   Tannerella forsythia: BFO_0996Help
Entry
BFO_0996          CDS       T01682                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
tfo  Tannerella forsythia
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tfo00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:tfo00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1078633..1079124)
Genome map
AA seq 163 aa AA seqDB search
MISIIVATDQRGAIGKDNSLLWRLPNDMKHFRELTVGHTVVMGRRTFESLPHGALPNRRN
MVLTTEWGAHFNNCLVYNTLWGALMDTEEEEEVFVIGGGNVYKQALEVADKLYLTLVHHT
FPEADTFFPPVDPKVWEEVSRTDVPTDEKNPYPHSFLTYVRKK
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgatatcgattatagtagccacagaccaacgcggagcgataggcaaagacaacagcttg
ctctggcgtctcccgaacgatatgaaacattttcgtgaactgaccgtcgggcataccgtc
gtcatggggcggcgaacgttcgagtctttgccccatggcgccttgcccaatcgccggaat
atggttcttacaaccgaatggggcgctcattttaataattgtttggtgtataatacgtta
tggggtgcgcttatggataccgaagaggaggaggaagtttttgtcatcggcggaggaaat
gtttacaaacaggcgttggaggtagccgataaactctatcttacgcttgtgcatcatacc
tttccggaggctgacacgttttttccacccgtcgatccgaaagtgtgggaagaagtatcc
cgaacagatgtgccgacagacgaaaaaaatccttacccgcacagttttttaacgtacgtt
cgaaaaaaataa

DBGET integrated database retrieval system