KEGG   Tannerella forsythia: BFO_1095Help
Entry
BFO_1095          CDS       T01682                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
tfo  Tannerella forsythia
Pathway
tfo00010  Glycolysis / Gluconeogenesis
tfo00030  Pentose phosphate pathway
tfo00051  Fructose and mannose metabolism
tfo00052  Galactose metabolism
tfo00680  Methane metabolism
tfo01100  Metabolic pathways
tfo01110  Biosynthesis of secondary metabolites
tfo01120  Microbial metabolism in diverse environments
tfo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tfo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BFO_1095
   00030 Pentose phosphate pathway
    BFO_1095
   00051 Fructose and mannose metabolism
    BFO_1095
   00052 Galactose metabolism
    BFO_1095
  Energy metabolism
   00680 Methane metabolism
    BFO_1095
Enzymes [BR:tfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BFO_1095
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     BFO_1095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AEW20526
UniProt: G8UHS7
Position
complement(1185211..1186221)
Genome map
AA seq 336 aa AA seqDB search
MKIGILSSGGDCPGINATIRGVGKTAIMHYGMEVIGIHNGFTGLLNRDTELFTERTLSGI
LNLGGTILGTSREKPFKKIIQSGDNKKPEIICRNYMEMGLDCLICIGGNGTQKTANKLFQ
IGLNVIGVPKTIDNDIYGTDLTFGFDTAVNIATEAIDRLHSTASSHKRVMVVEVMGHSAG
WIALYAGMAGGADIILIPELGFDIRKVNEKILHRLHLGKPYSIIVTAEGLKTDCLSPADY
ISHAVGEATGIEVRQTVLGYIQRGGNPSPFDRNLATLLGGHATELVAQKQFGRMVCFKDG
KIGSVPLAEIAGKTKRVSSDNELIKQGERMGISFGI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcggtattctttcgtcgggcggagattgtcccggcatcaatgcgacgattcgc
ggagtaggtaaaacggccatcatgcactatggcatggaggtgataggcatccataacggc
tttacgggtttgcttaatcgagataccgagctcttcacggaacgaacgctttcgggtatt
ctgaatctgggaggaacgattctcgggacttcgcgcgagaaacctttcaaaaagattatt
cagtccggtgacaataaaaagccggagatcatctgccggaactatatggaaatgggactt
gactgtcttatctgcatcggcggaaacggtacgcagaagacggcgaacaaacttttccaa
atcggactgaatgtgattggagtacccaaaacaatcgataatgatatttacggtacggac
ctcacgtttgggtttgatacggcagtcaatattgcgaccgaagcgattgatcgtctgcac
tcgacagccagttcgcacaagcgtgtgatggttgtcgaagtgatgggacatagcgccgga
tggattgcactctatgccggtatggcaggtggtgcagatattatccttattcctgagctg
ggttttgatattcgtaaagtcaatgaaaagatattgcaccgtttgcatcttggcaaaccg
tattccatcattgtgacagcggaaggactgaagacggattgtctcagtccggctgattat
atttcgcatgccgtgggagaggcgacgggcattgaagtgcgtcagacagtgcttggatat
attcagcgcggcggaaatccctctcctttcgaccgcaatctggctacacttcttggcggt
catgcgaccgagcttgtggctcaaaaacagttcgggcgtatggtctgttttaaagacgga
aaaatcggctccgtgccgctcgccgaaattgcgggcaagacgaaacgcgtatcatccgat
aatgagcttattaaacaaggggagcgtatggggatttcgttcgggatatga

DBGET integrated database retrieval system