KEGG   Tannerella forsythia: BFO_1095Help
Entry
BFO_1095          CDS       T01682                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tfo  Tannerella forsythia
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tfo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BFO_1095
   01230 Biosynthesis of amino acids
    BFO_1095
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BFO_1095
   00030 Pentose phosphate pathway
    BFO_1095
   00051 Fructose and mannose metabolism
    BFO_1095
   00052 Galactose metabolism
    BFO_1095
  Energy metabolism
   00680 Methane metabolism
    BFO_1095
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BFO_1095
Enzymes [BR:tfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BFO_1095
Protein phosphatases and associated proteins [BR:tfo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BFO_1095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1185211..1186221)
Genome map
AA seq 336 aa AA seqDB search
MKIGILSSGGDCPGINATIRGVGKTAIMHYGMEVIGIHNGFTGLLNRDTELFTERTLSGI
LNLGGTILGTSREKPFKKIIQSGDNKKPEIICRNYMEMGLDCLICIGGNGTQKTANKLFQ
IGLNVIGVPKTIDNDIYGTDLTFGFDTAVNIATEAIDRLHSTASSHKRVMVVEVMGHSAG
WIALYAGMAGGADIILIPELGFDIRKVNEKILHRLHLGKPYSIIVTAEGLKTDCLSPADY
ISHAVGEATGIEVRQTVLGYIQRGGNPSPFDRNLATLLGGHATELVAQKQFGRMVCFKDG
KIGSVPLAEIAGKTKRVSSDNELIKQGERMGISFGI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcggtattctttcgtcgggcggagattgtcccggcatcaatgcgacgattcgc
ggagtaggtaaaacggccatcatgcactatggcatggaggtgataggcatccataacggc
tttacgggtttgcttaatcgagataccgagctcttcacggaacgaacgctttcgggtatt
ctgaatctgggaggaacgattctcgggacttcgcgcgagaaacctttcaaaaagattatt
cagtccggtgacaataaaaagccggagatcatctgccggaactatatggaaatgggactt
gactgtcttatctgcatcggcggaaacggtacgcagaagacggcgaacaaacttttccaa
atcggactgaatgtgattggagtacccaaaacaatcgataatgatatttacggtacggac
ctcacgtttgggtttgatacggcagtcaatattgcgaccgaagcgattgatcgtctgcac
tcgacagccagttcgcacaagcgtgtgatggttgtcgaagtgatgggacatagcgccgga
tggattgcactctatgccggtatggcaggtggtgcagatattatccttattcctgagctg
ggttttgatattcgtaaagtcaatgaaaagatattgcaccgtttgcatcttggcaaaccg
tattccatcattgtgacagcggaaggactgaagacggattgtctcagtccggctgattat
atttcgcatgccgtgggagaggcgacgggcattgaagtgcgtcagacagtgcttggatat
attcagcgcggcggaaatccctctcctttcgaccgcaatctggctacacttcttggcggt
catgcgaccgagcttgtggctcaaaaacagttcgggcgtatggtctgttttaaagacgga
aaaatcggctccgtgccgctcgccgaaattgcgggcaagacgaaacgcgtatcatccgat
aatgagcttattaaacaaggggagcgtatggggatttcgttcgggatatga

DBGET integrated database retrieval system