KEGG   Tannerella forsythia: BFO_1338Help
Entry
BFO_1338          CDS       T01682                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
tfo  Tannerella forsythia
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:tfo00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    BFO_1338
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BFO_1338
Enzymes [BR:tfo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BFO_1338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1428740..1429339
Genome map
AA seq 199 aa AA seqDB search
MKRTMLALLSLCFVWTAMAQSGIYDITVKDAEGKEVLLKEYEGKTLLIVNTATGCGFTPQ
YEALEKLYEQYREQGFVVLDFPCNQFGEQAPGTIEEIKDFCTLKYGTKFPLFEKIEVNGE
NESPLYTYLKSQKGFEGFTGERADAMNAMLKKKDKDYASKPDIKWNFTKFLVDKQGNVVA
RFEPTAGMDEVEKAIRALL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaacaatgttagcgctgctgtcgctttgttttgtatggacagctatggcgcag
agcgggatttatgacatcaccgtcaaggatgccgaagggaaagaggtcttgctgaaagag
tacgagggtaagacgctgctgattgtaaatacggcgacagggtgtggttttacgcctcaa
tacgaagccttggaaaagctttatgagcaatacagggaacaaggctttgttgtcctcgac
tttccctgcaaccagtttggcgagcaggcaccgggtacgatagaagagattaaggacttc
tgcaccctgaagtacggaacgaagtttccattgtttgagaaaatcgaggtgaacggcgag
aacgaatcgccgctctatacgtatctgaagagccaaaaaggcttcgaaggttttaccggt
gaacgagccgatgccatgaatgccatgctcaagaagaaagacaaagactacgcaagcaag
cccgatatcaaatggaacttcacgaagtttctggtcgataagcaagggaacgtggtggct
cgcttcgagcccaccgccggcatggacgaggtggagaaagctatccgggctttgttgtaa

DBGET integrated database retrieval system