KEGG   Tannerella forsythia: BFO_1338Help
Entry
BFO_1338          CDS       T01682                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
tfo  Tannerella forsythia
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:tfo00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:tfo00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1428740..1429339
Genome map
AA seq 199 aa AA seqDB search
MKRTMLALLSLCFVWTAMAQSGIYDITVKDAEGKEVLLKEYEGKTLLIVNTATGCGFTPQ
YEALEKLYEQYREQGFVVLDFPCNQFGEQAPGTIEEIKDFCTLKYGTKFPLFEKIEVNGE
NESPLYTYLKSQKGFEGFTGERADAMNAMLKKKDKDYASKPDIKWNFTKFLVDKQGNVVA
RFEPTAGMDEVEKAIRALL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaacaatgttagcgctgctgtcgctttgttttgtatggacagctatggcgcag
agcgggatttatgacatcaccgtcaaggatgccgaagggaaagaggtcttgctgaaagag
tacgagggtaagacgctgctgattgtaaatacggcgacagggtgtggttttacgcctcaa
tacgaagccttggaaaagctttatgagcaatacagggaacaaggctttgttgtcctcgac
tttccctgcaaccagtttggcgagcaggcaccgggtacgatagaagagattaaggacttc
tgcaccctgaagtacggaacgaagtttccattgtttgagaaaatcgaggtgaacggcgag
aacgaatcgccgctctatacgtatctgaagagccaaaaaggcttcgaaggttttaccggt
gaacgagccgatgccatgaatgccatgctcaagaagaaagacaaagactacgcaagcaag
cccgatatcaaatggaacttcacgaagtttctggtcgataagcaagggaacgtggtggct
cgcttcgagcccaccgccggcatggacgaggtggagaaagctatccgggctttgttgtaa

DBGET integrated database retrieval system