KEGG   Tannerella forsythia: BFO_1348Help
Entry
BFO_1348          CDS       T01682                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
tfo  Tannerella forsythia
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:tfo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BFO_1348 (folP)
Enzymes [BR:tfo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     BFO_1348 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1441315..1442157)
Genome map
AA seq 280 aa AA seqDB search
MKEKSINLNGRLLSLKSPVVMGILNVTPDSFYAGSRQADEAAVAQRIETILAEGGAIVDI
GGYSSRPDAAEVTEEEEWQRIKPALKRMQRDFPEVPVSVDTFRSVIARRAVEEYGTAMIN
DISGGMLDARMFETIALLQVPYILMHMRGTPQTMQQHTDYDDLMEDIMLYFAQKVRALRQ
LGVNDVILDPGFGFAKTLEQNYELMRSLSEFSIHFETPLLVGISRKSMIYKLLNATPEDS
LNGTTVLNTYALLNGADILRVHDVKAATETIEIVKRLMQS
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagaaatcaatcaatttgaacggacggctgttatcgttgaagtcgccggttgtc
atggggattctgaacgtcacgcccgattcgttttatgcagggagccgtcaggcagacgag
gcagccgtagcacagcgcatcgagacgatattggctgaaggtggagcaatcgtcgatatt
ggaggatattcgtcacgccccgatgcggcagaggttacggaggaggaggaatggcaacgg
attaagcctgctctgaagcggatgcagagagattttcccgaggttcccgtttcggtcgat
acgtttcgctcggtgattgcgcgacgtgccgtcgaagaatacgggacagccatgatcaat
gatatctcgggcggtatgcttgatgcacggatgtttgaaacaattgcgttacttcaggtg
ccatatatcttgatgcatatgcgcggaacgcctcagactatgcaacagcatacagactat
gacgatctgatggaagacatcatgctctattttgctcaaaaagtcagggcgctccgacaa
ttgggggtgaatgatgtgattctcgatcccggcttcggatttgccaaaacccttgaacaa
aactatgaactgatgcgatcgctatccgaattctcgatccattttgaaacgcccctgtta
gtcgggatatctcgaaaaagcatgatatataaattattgaatgcaactcccgaggacagc
ttgaatggcacgaccgtgttgaatacgtatgccctcctgaacggcgccgacatcctgcgt
gtgcacgatgtgaaggccgctaccgaaaccatagaaatcgtaaaacggctcatgcaatct
taa

DBGET integrated database retrieval system