KEGG   Tannerella forsythia: BFO_1488Help
Entry
BFO_1488          CDS       T01682                                 

Definition
aldehyde-alcohol dehydrogenase family protein
Orthology
K18119  
succinate-semialdehyde dehydrogenase [EC:1.2.1.76]
Organism
tfo  Tannerella forsythia
Pathway
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tfo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BFO_1488
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BFO_1488
Enzymes [BR:tfo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.76  succinate-semialdehyde dehydrogenase (acylating)
     BFO_1488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1592233..1593591
Genome map
AA seq 452 aa AA seqDB search
MEIKEMIARARAAQKEYQERFNQDTVDEVVKAATKVVYDRAELLAQMAIDETQMGVYEHK
VAKNRNKAKGVWSNLQGKKSMGVMDIDDKTGLIKIAKPVGVVAAITPMTNPIVTPMANIA
FALKTKNAIIVAPHPKAKNCSTYTVNKIVECLRNYNVPEGLIQIIEEPSIEKTQELMASV
DVVVATGGMQMVHSAYSSGKPSFGVGAGNVQVILDRFIDYDEAADKIITGRAFDNGIICS
GEQSFIYHAKDKQEVFESFVKHGAYFVPEEDREKVVNAIFNNGALCRDIVGQSVEMISRK
AGISVPEGTRVLVVQAHGVGQEDMICKEKMCPVMACFPYNYFEEAIDIAKTNLNLEGSGH
TAGIHSNDQANIIKAGMEISVSRLIVNAPCSITAGGSIQNGLSVTTTLGCGSWGNNSISE
NFTYKHLLNITRVAQVSPHIQIPTDDEIWAMK
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaaagaaatgatcgcccgagctcgcgcggcacagaaggagtatcaggaaaga
tttaatcaggacacggtcgacgaagtcgtaaaagcagcgaccaaagtcgtatatgatcgt
gccgaattattggcgcagatggccatcgacgagacgcagatgggggtgtacgaacacaag
gtcgccaaaaacagaaataaggcgaaaggcgtatggagtaacctgcaaggtaaaaaatcg
atgggagtgatggatatcgatgacaaaacaggactgattaaaatagccaagcccgtagga
gtcgttgcggccatcacaccgatgacaaacccgattgtgaccccgatggctaatatcgct
ttcgcgttgaagacgaagaatgccatcatcgtagcaccgcatcccaaagccaaaaattgt
tcgacatacacggtcaacaaaatcgtcgagtgtctgcgcaattataacgttcccgaagga
ctgattcagatcatcgaagagccaagcatcgaaaagacgcaggaacttatggcttccgtc
gatgtggtggtggctaccggaggcatgcagatggtacattcggcctattcgtcgggcaaa
ccgtcgttcggcgtgggagccggcaacgtacaggtgatcctggaccgttttatcgattac
gacgaagcagccgacaagattatcacggggcgtgctttcgacaacggcatcatttgttcg
ggcgagcagagttttatctatcatgcgaaagataaacaggaagtttttgaatctttcgta
aagcacggtgcatatttcgtacccgaagaagaccgtgagaaagtcgtgaatgccatcttc
aataacggcgctctttgtcgcgacatcgtagggcagagtgttgaaatgatcagtcgaaaa
gcaggtatctccgttcctgaaggaaccagggtactggtcgtgcaggctcatggagtcggc
caggaagatatgatatgtaaagagaagatgtgccctgtcatggcctgcttcccgtataat
tattttgaagaagccatcgatattgcaaagacgaatttgaacctcgaaggcagcggccat
acggcaggtatccactcgaacgatcaggccaatatcatcaaagccggaatggaaatctcc
gtctcacgcctgattgtcaatgcaccttgttccatcactgccggcgggtcgattcagaat
gggttgtccgtgaccaccacgctgggatgcggaagctggggaaataattccatctcggag
aactttacctacaaacacttgctcaatatcacacgcgttgcacaggtgtcaccgcatatt
cagatccctaccgacgacgaaatctgggcaatgaaataa

DBGET integrated database retrieval system