KEGG   Tannerella forsythia: BFO_1897Help
Entry
BFO_1897          CDS       T01682                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tfo  Tannerella forsythia
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tfo03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2020587..2021177)
Genome map
AA seq 196 aa AA seqDB search
MIEYIRGEIVELSPAQMVIECAGIGYGLNISLTTYSAFDKCGEGKVYVHEVIREDAHLLF
GFASREERELFLLLTSVSGVGPNTARMILSSLKPSGLIDVIASGDDVSLTAIKGIGSKTA
QRIVVDLKNKVRPVEGLDERKASAGMGRPATGEEAVAALVMLGFQKASSQKAVDSLLKKT
PDMTVEQLIKTALTML
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaatatataagaggcgaaatcgtcgaactgtctcccgcacagatggtcatcgaa
tgtgcagggatcggctacgggctgaacatctcgctcacgacgtacagtgcgttcgacaaa
tgcggcgaagggaaagtgtacgtacacgaagtgattcgggaagatgcgcatttgctgttc
ggctttgccagtcgtgaagaacgcgaattgttcttgctccttacctccgtttcgggtgta
ggaccgaatacggcgcgcatgattctctcatcactcaaaccctccggtctgattgatgtc
atcgcctcgggcgatgatgtgagtctgacagccatcaaaggtatcgggagcaagacggcg
caacgcatcgtagtcgatctgaaaaataaagtcagacccgttgaaggactcgacgaacgt
aaagcctccgcaggaatgggacgcccggctacgggtgaagaagccgtagccgcgctggtg
atgctcggttttcagaaagcgtcatcacaaaaagccgtagattccctcctgaaaaagacg
ccggacatgacggtggaacaattgatcaaaaccgcccttacaatgctttaa

DBGET integrated database retrieval system