KEGG   Tannerella forsythia: BFO_2191Help
Entry
BFO_2191          CDS       T01682                                 

Definition
hypothetical protein
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
tfo  Tannerella forsythia
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:tfo00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:tfo00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:tfo00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:tfo00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2344247..2345140
Genome map
AA seq 297 aa AA seqDB search
MRFFYSFVFLLLSYCSLYAQQPSGREGALSRIDSFRTVLRERIEATRTNYNADSVRAMIE
NGPYFGVFKDNYFIGGIPVGQKIKADNSNVKFQISVIQRLTKSKLPFDTYLFLQFTQKTV
WNVLEESLPIRDMNFNPGIGIGHLIVYQNRYIGKAFLMLEHESNGKDREASRSWNKVSLS
GSLMASPHVELQLKAWIPIIDGENNRDILRYNGLGHFGLSYRTSNRRIQAGILATWRNKS
FSFNTQWELSYKLHKNENQYLFLQYYNGYGENLLDYDRFKSVVRLGMVIKPQDFSIF
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagatttttttattcatttgtctttttgttgttaagttattgttctctctatgcgcag
cagccttcgggaagggagggcgcgttgagccgtatcgacagtttccgaacggtcctcagg
gagaggatcgaggcgacacgaacgaattataatgccgacagtgtgcgtgcgatgattgaa
aatggcccgtatttcggggtgtttaaggataattattttatcggtggcatccctgtcggt
cagaagattaaagcagataactcgaatgtgaaatttcaaatcagcgtgatccagcgtctg
accaaaagcaaattgccgttcgacacttatttgtttcttcagtttacgcaaaagacggtt
tggaatgtattggaagaatctctgccgatacgtgatatgaacttcaatccaggcattgga
atcggacacctgattgtttatcagaatagatatatcggaaaggcttttttgatgcttgaa
cacgaatcgaacggaaaagatcgagaagcctcgcgtagctggaacaaagtatcgcttagc
ggaagtttgatggccagtccgcatgtggaattacagctcaaagcctggataccgattatc
gatggtgagaacaaccgggatattctccgatataacggtttgggacacttcggactcagt
taccgtacaagtaaccgacggattcaagccggaatacttgctacgtggcgtaacaaatcc
tttagcttcaatacgcaatgggaacttagctataaattgcataagaatgaaaaccagtat
ctgtttctccagtattataacggatacggtgagaatctgctggattacgacagattcaaa
agcgtcgttcgtctcggcatggtaatcaagccgcaagactttagcattttctga

DBGET integrated database retrieval system