KEGG   Tannerella forsythia: BFO_2501Help
Entry
BFO_2501          CDS       T01682                                 

Definition
putative 4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
tfo  Tannerella forsythia
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tfo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BFO_2501
Enzymes [BR:tfo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     BFO_2501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2524781..2527426)
Genome map
AA seq 881 aa AA seqDB search
MCVCGSIPELGCNEPVMAKEMACADGEHWSLRLEIPDDMTEIEYHYLLRDADRKVTPEPW
RRKHRIAFDRTAASYCLYDYWREEPTNIALYTSAFTKNLFAHNGSEPIHEQPDRSLIIRV
PNPRVRKNQRVALAGNQACLGHWDTTQAKLLCPSGAAEWEVCLNADEISYPFEYKFFVCD
ETKRVCHWEKGDNRVLAKTPSATCEVTVISEYPYREDLPEWKGAGTVIPVFSLRSEQSFG
VGDLHDLRLLIDWAEQTQQCVIQVLPMNDTTCTHTWKDSYPYSAISMYALHPMYISLYSM
GTLNDPDRMAYFRKKQIALNEKEEVDYEAVERYKTTYCRAFFEQEGAAILSGCDFKRFLE
NNRKWLTPYAAFCYLRDQYHTADFSQWGKDAIYSPLRIEKLCAENSPAYPEISYVYFLQY
VLHSQFQAVSNYARRKGIILKGDLPIGIHRTSVEAWTEGRYFQMNGQAGAPPDDFSALGQ
NWSFPTYNWEVMEEDGFTWWKKRFGKMSDYFDSFRIDHILGFFRIWEIPLDYVQGLCGHF
RPALPLTAGEIESYGLAFKKEYTLAIIHRKYLPELFGEQTVTVTDHYLFPMDAEHMMLNP
FCDTQRKIQRLFKGKEDNVSQQIQSGLYALANEVLFLEDPYEPGKYHPRISSSKSYRYQE
LTETEQTAFDKLYAYFFYERHHDFWKTTALSRLRPLVATTEMLVCGEDLGMIPDSVHEVM
EELHILSLELGRISKVFGQEFTDLKTAPYNSVCTTSTHDMSPLRTWWEEDPKRTQRYAEF
VLKETEAPPKECTPEIAERIIAEHLHAHSILTIFPLQDWLAIDHYLRRKDASQERINLPA
DPDHYWRYRIHIPLEQLLQASEFNQKIRAMLSKSHRTNTIT
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgtgtgtggctccattcccgagttgggctgtaacgagccggtcatggcaaaagaa
atggcttgtgcagacggtgaacattggtcgttacgccttgaaatacctgacgatatgacc
gaaatcgagtatcactatctcctgagagatgcagaccgcaaagtaacccccgagccgtgg
cgtcgaaagcatcgcatcgcattcgaccgtacagcggcaagttattgcctgtacgactat
tggcgcgaagagccgacgaatatcgcattgtatacttcagcgtttacgaagaatctgttt
gctcacaacgggtctgaacccattcatgaacagcctgatcgcagtttgatcattcgggtt
ccgaatccccgggtgcggaaaaatcagcgggtcgctcttgccggcaatcaggcatgtctg
ggacattgggatacgacgcaagccaagctcctatgcccgtccggcgctgcagaatgggaa
gtttgcctcaacgccgatgagatcagctatccgtttgagtataaatttttcgtttgtgat
gaaacgaaacgggtctgccactgggaaaaaggagacaaccgcgtactggcaaagacacct
tcagcgacatgcgaggtcacagtgatttcagaatatccgtatcgtgaagatttgcccgaa
tggaaaggagcagggaccgtcatccctgttttttcgttacgttccgaacaaagtttcgga
gtaggtgacctgcatgacctccgattattgatcgactgggccgagcagacacagcaatgt
gttatccaagtgctcccgatgaatgacacgacttgtacgcatacgtggaaagactcttat
ccttacagcgccatctcgatgtatgctctgcatccgatgtatatctcgctatacagcatg
ggaaccctcaacgatccggaccggatggcttatttccgaaagaaacagattgctctgaat
gaaaaggaagaagtcgattacgaagcggtcgaacgttataaaacgacatattgccgcgct
ttctttgaacaggaaggtgcggccattttatcgggttgcgatttcaaacgtttcctggag
aataaccgaaaatggctgactccatacgcagcattttgttatttacgggatcaataccat
acggccgatttctcacaatgggggaaagacgcgatatacagtccgctccggattgaaaaa
ctatgtgcggaaaacagcccggcgtacccggaaatttcgtatgtctattttctgcaatac
gttttacatagccagtttcaagctgtttcgaactatgcccgccggaaaggaatcatcctg
aaaggagatctcccgatcggcattcaccgaacgagcgtcgaggcatggacggaaggccgt
tacttccagatgaacggtcaagcaggtgctccgcccgatgacttctctgccttaggacaa
aactggtctttcccgacctataattgggaggtcatggaagaagacgggttcacgtggtgg
aagaaacgtttcggtaagatgagcgattatttcgacagttttcgcatcgatcatattctc
ggattctttcgtatctgggaaattccgctcgattacgtacaaggattatgcggacacttc
cgaccggcattgccgttgaccgccggtgaaatagaatcgtacggtttagcgtttaaaaag
gaatatacattggcaatcattcaccggaaatacctgccggagctatttggtgagcaaacg
gtaactgttaccgatcactatcttttccccatggatgcggaacatatgatgctgaatccg
ttttgtgatacccagcggaaaatacagagactcttcaaggggaaggaagataacgtatct
caacagattcaatccggtctttatgcattagccaatgaggtactttttctggaagaccca
tacgagccgggaaaatatcatccgcgcatatcatcctcgaagtcataccgttatcaggaa
ctgacggaaacagagcaaacagctttcgacaagctttatgcttactttttttacgaacgg
catcatgacttttggaaaacgacggcgctaagcaggctccgtcccttggttgcaacaaca
gaaatgctggtgtgcggagaagatttggggatgattcccgactccgtacacgaagtgatg
gaagaactgcacatcctgagtctggagttgggccgcatatccaaagtcttcgggcaagaa
ttcaccgacttgaaaacagccccctacaactctgtctgcacgacttcgacacacgatatg
agccctttgcgtacatggtgggaagaagacccaaaacgtacgcaacgatatgctgagttt
gtcttaaaagaaaccgaagcgccccccaaggaatgcacccccgaaatagccgagcgaata
atcgccgaacatctgcatgcacattccatactgaccatctttcctttgcaggattggctg
gccatagaccattacttgagacgaaaagacgcctcacaagagcgtatcaatctcccggca
gaccctgatcattattggcgttaccgcatacacatcccgctcgaacagcttttacaagcc
tccgaattcaatcaaaaaatccgtgcgatgctctcaaagagtcatcgcacaaatacaatc
acttga

DBGET integrated database retrieval system