KEGG   Tannerella forsythia: BFO_2613Help
Entry
BFO_2613          CDS       T01682                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tfo  Tannerella forsythia
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tfo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BFO_2613 (tpiA)
   00051 Fructose and mannose metabolism
    BFO_2613 (tpiA)
   00562 Inositol phosphate metabolism
    BFO_2613 (tpiA)
Enzymes [BR:tfo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BFO_2613 (tpiA)
Exosome [BR:tfo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BFO_2613 (tpiA)
  Exosomal proteins of bladder cancer cells
   BFO_2613 (tpiA)
  Exosomal proteins of melanoma cells
   BFO_2613 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2647597..2648352
Genome map
AA seq 251 aa AA seqDB search
MRKNIVAGNWKMNTTLPEGLALAKGLNAALKGKAVHCDVIVGVPFTHLASIVSAVDTMKI
GVAAENCADKEKGAFTGEVSAAMVASTGAKYVILGHSERRAYYHETPGILKEKVKLALAH
NLIPIFCIGEVLEEREAGKHFEVVDAQVRESLFELSAEEFGKLVLAYEPVWAIGTGKTAT
AEQAQEIHAHIRHTIAQQYGPEVADSTSILYGGSCNAGNAKELFANPDVDGGLIGGASLE
VEKFMPVIEAF
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagaatattgttgcggggaactggaagatgaacaccaccctgcccgaaggattg
gcgctggccaaaggtttgaatgcagccttgaaaggaaaggccgtacattgcgacgtgatt
gtaggtgtaccgttcacgcatctggcaagtatcgtttcggccgtcgacacgatgaagatt
ggggtggcagcggagaactgtgccgacaaggaaaagggagcttttacgggcgaggtgtcg
gctgcgatggtcgcttcgacgggcgctaagtacgtgattctcggacattcggagcgtcgt
gcatattaccacgagactcccgggattttgaaggaaaaagtgaagctggcgttggcacat
aatctgataccgattttctgcatcggcgaagtgctggaagagcgcgaggccggcaagcat
ttcgaagtcgtagatgcacaagtacgtgaatcgctgttcgagctatcggccgaagaattc
ggcaagttggtgctcgcttacgaaccggtgtgggctatcggaacgggcaaaacggctacg
gcggaacaggcacaggagattcatgcacacattcgccataccattgcgcagcaatatggt
ccggaggtcgccgacagcacatccattctgtatggcggaagttgcaatgcgggcaatgcg
aaagaattgtttgccaaccccgatgtagatggcgggctgattggcggagcatcgctcgag
gtagagaaatttatgcccgtcattgaggcattttaa

DBGET integrated database retrieval system