KEGG   Tannerella forsythia: BFO_2615Help
Entry
BFO_2615          CDS       T01682                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
tfo  Tannerella forsythia
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tfo00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2648864..2649445
Genome map
AA seq 193 aa AA seqDB search
MKETEALLEVRRQVSEHYRQIIELLGEDTDREGLKKTPMRVAKAMQFLLKGYDEDPEAVL
ASAMFKEEDYKQMVIVKDIDFFSLCEHHMLPFFGKVHVAYIPNHYITGLSKIPRIVDIFA
HRLQIQERMTLQIKECLQKTLNPLGVMVVIEAQHMCMQMRGVEKQNSLTTTSDFTGSFQQ
ARTREEFMNLIKK
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagaccgaagcattactcgaagtacgccggcaagtgagcgagcattatcgtcaa
atcattgaactgttgggtgaagatacggatcgtgagggattgaagaaaacccccatgcgg
gtggctaaggccatgcagtttctgctcaagggatacgatgaagacccggaggccgtgttg
gcctcagccatgtttaaggaagaggactataagcagatggttatcgttaaggacatcgat
tttttttctctctgcgagcatcacatgttacctttcttcggtaaggtgcatgtggcttat
attccgaatcattacattacgggactgagtaaaattccgcgcatagtcgatatttttgct
catcgtttgcagatacaggagcgtatgacacttcagattaaggaatgtcttcagaaaacg
ttaaacccgctgggcgtgatggtcgtcattgaggcgcaacacatgtgcatgcagatgcgc
ggcgtggaaaaacagaactcactgacaacgacatccgactttaccggctcgtttcaacaa
gcccgaacgcgtgaagagtttatgaacctgattaaaaaatag

DBGET integrated database retrieval system