KEGG   Tannerella forsythia: BFO_2659Help
Entry
BFO_2659          CDS       T01682                                 

Definition
alkaline phosphatase family protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
tfo  Tannerella forsythia
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tfo00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:tfo00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:tfo02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2690146..2691777
Genome map
AA seq 543 aa AA seqDB search
MEPEQVKPVKNLIVLIPDGTSLATISTARWYQWYMNPDMPKLAIDPYICGTVRTHSSNAP
IGDSAPTTSCYMTGHPSRTGYVATYPPHDPGNDIYPMDPKRAYQPMMTLLEAMKLVQHKA
TGLVFTCEFTHATPADCSAHSYSRKRYEWIAPQMVHNDIDVVIGGGTSLLDEAGEAYLKA
NGYNVYRNDMAGMRSDNSNKMWALFGDRDMAYDIDRDPAQQPSIEEMTKKALDKLSKNEN
GFFLMVEGSKVDWAAHGNDPVGMLTDYLAFDKACRVAFDFARRDGHTLVVMVSDHGNSGF
SLGRRDCKGYDKLTKDQLFGTVTQIKLSADGFAKKLNEQPSSAVQEIFRQYAGFELTDEE
LQSLYHCKGYKNSPIPENERSEKEALASLYSSSLNGFIAKLITSKTCFGFTTNGHTGEDV
LLAAYHPAGTLPMGMHTNIELNHYMTAAVGLTGKLDELTDANFAPHTEVLKGYTYSILPP
ATEKENPTLVVKNKKKQLTITPYTNIVKLGKKGKEEMRLQTVIVYVDKNETFYLPRTITD
YLK
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggaaccggaacaggtaaaaccggttaaaaacctgattgtcttgatccctgacgggacg
tcgctggccacgatctctaccgcccgctggtatcagtggtacatgaaccctgacatgccc
aagctggctatcgacccttacatctgtggtacggtacgcacacactcgtcgaacgctccg
atcggcgactcggcaccaaccacttcatgctatatgaccggtcaccccagtcgtacaggc
tatgtggcgacctatccgccgcatgatcccggaaatgacatttatccgatggacccgaaa
cgcgcctaccagccgatgatgacgctgttagaagccatgaaacttgtgcaacacaaggct
acgggattagtcttcacctgtgaatttacgcacgcaacaccggccgactgctcggcgcac
agttacagccgcaaacgttacgaatggatcgctccgcagatggtacataacgatattgat
gtagttattggcggaggcacttcgctgctcgacgaagccggcgaagcttatctgaaagca
aacggatacaatgtataccgtaacgacatggccggaatgcgcagcgacaactcgaataaa
atgtgggccctgttcggcgaccgtgatatggcgtatgacatcgaccgcgacccggcacaa
caaccgtccatcgaagagatgacgaaaaaagcattagacaaactctcgaagaacgaaaac
ggtttcttcctgatggtagaaggaagtaaagtagactgggcagcgcacggcaacgatccg
gtgggcatgctgaccgattatctggctttcgacaaggcgtgccgcgtagcgttcgatttt
gcacgccgcgacggccatacgctcgttgtgatggtatccgaccatggaaacagcgggttc
agcctcggacgccgcgactgcaaaggatacgacaaactcacgaaagatcagctgttcgga
accgttacacaaatcaaactctcggccgacggatttgccaagaagctcaacgaacaaccg
tcttcggccgtgcaggagattttccgccaatatgccggctttgaattgaccgacgaagaa
ctccagagtctctatcattgcaaaggctacaagaacagtccgatccctgagaacgaacgc
agtgagaaagaagcacttgcatcgctctacagcagctcgctgaatgggttcattgccaaa
ctgattacctcgaaaacatgcttcggctttacaacaaacggccatacgggcgaagatgta
cttctggcggcctatcatccggcaggtactctgcctatgggaatgcatacgaatattgag
ctgaaccattatatgaccgccgccgtggggctgacgggcaaattggacgagctgaccgac
gccaacttcgcaccgcataccgaagtgctgaaaggctatacgtattccatattgcctccg
gctacggaaaaagaaaaccccacactggtggtgaaaaacaagaaaaaacagctcaccatc
acgccttatacgaacattgtcaaactgggcaagaaaggaaaagaagaaatgcggctgcag
acggtgatcgtctatgtcgacaagaacgaaaccttttacctgcctcgtacgattaccgac
tatttgaaataa

DBGET integrated database retrieval system