KEGG   Tannerella forsythia: BFO_2803Help
Entry
BFO_2803          CDS       T01682                                 

Definition
(GenBank) O-Glycosyl hydrolase family 30
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
tfo  Tannerella forsythia
Pathway
tfo00511  Other glycan degradation
tfo00600  Sphingolipid metabolism
tfo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tfo00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BFO_2803
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BFO_2803
Enzymes [BR:tfo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     BFO_2803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 DUF5390 Glyco_hydro_30C
Motif
Other DBs
NCBI-ProteinID: AEW22095
UniProt: G8UN85
Position
2834126..2835607
Genome map
AA seq 493 aa AA seqDB search
MKRFSKRILMFSCLAMSVSNLYAQSYTWFCSTENDVWKETKIKLQSKSETAPILKVTGAE
SIQIFKRWGTCFNELGWDALNLLSLEQQDAILSKLFSPDGELHFSMGRIPMNANDYARDW
YSCDEVDGDFQLKYFNIDRDKKTIIPFIRKALHYNPNMTFWASPWSPPSWMKVNHYYSIL
SNDKVNKMSPLSNVILHENSTERNDAYYPKQLAVNDYFIQDTRYLRTYADYFCRFISAYQ
DENIPVTKVMFQNEPWAFTIYPGCAWTPEGIIRFNVEYLAPELEKRHPDVSLYLGTLNTN
RFEIVDKILSDPRMHKTVDGLGFQWWGGQILPDIRKKYPHYKYMQTENECGSGTFDWKAA
EHTFNLINHYLGNGCEEYTFWNAILCDEGTSGWGWKQNALIHVDSKTEAVTYTPEYYAVR
HFSDKVTSGTKVLQYKEKGDDKLPAMVFLTSDNKYLVVAGNFNDEPRKLTIQLGAKFLVA
TLKPHSFNSFYMK
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagattctcaaaaagaatcttgatgtttagttgcctggcaatgagtgtgtctaac
ttgtatgctcaatcttatacatggttttgcagtacagagaatgatgtatggaaagagacg
aagataaagttacaatcgaagagtgaaacggctccgatattgaaggtcacaggagcagaa
agtatacaaatatttaaaagatggggaacctgttttaatgaattgggatgggatgcactt
aacctgttatctcttgagcaacaggacgccattttaagcaaactgttctcacccgatggt
gaattgcatttctctatggggcgcatcccgatgaatgctaatgactatgcccgcgactgg
tatagttgcgatgaagttgacggcgattttcaattgaaatattttaatattgatcgcgat
aaaaaaacgattatacctttcataagaaaagcactgcattataatccgaatatgactttc
tgggcctcgccatggtcgcccccctcgtggatgaaagtaaatcattattattcgattctc
agtaatgataaagtgaataagatgtctcctttatccaatgttattcttcatgagaacagt
acggagagaaatgatgcttactaccccaagcaacttgccgtgaatgactattttattcag
gatacacgttatttgagaacgtatgctgattatttttgcagattcatttccgcttatcag
gatgaaaatattcctgtaacaaaggtgatgttccagaatgagccatgggcgtttaccata
tatccgggttgtgcatggactccggaaggaatcattcgttttaatgttgagtatttagct
ccggaattagagaaacggcatcccgacgtttctctttatctgggaacgcttaacacaaat
cgttttgaaatagtcgacaagattctctctgaccctcgcatgcataaaacggtggacggt
ttaggatttcaatggtggggggggcagattttgcctgatattcgtaaaaaatatcctcat
tataaatatatgcagacagaaaacgaatgcggttcggggacttttgactggaaagcggcg
gagcatacgtttaatttgataaatcattatttaggaaatggttgtgaagagtatacattt
tggaatgcgatattgtgtgacgagggtacaagcggatggggatggaaacagaatgctctg
attcatgtggattctaaaaccgaggcggtaacttatactccggaatattatgccgtgaga
cattttagtgataaagtaacttccggtacaaaggtgttacagtacaaagaaaaaggtgat
gataaattacccgctatggtttttctaacttcagataataaatatttggtagtggcaggt
aactttaatgatgagccacggaagttgacaatacaattaggagctaaatttttagttgca
actttaaagccgcattcgtttaattccttttatatgaaataa

DBGET integrated database retrieval system