KEGG   Tannerella forsythia: BFO_2807Help
Entry
BFO_2807          CDS       T01682                                 

Gene name
xylA
Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
tfo  Tannerella forsythia
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:tfo00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tfo00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2838435..2839751
Genome map
AA seq 438 aa AA seqDB search
MATKEYFPGIGKIKFEGKESMNPMAFRYYDAEKVVMGKKMKDWLKFAMAWWHTLCAEGGD
QFGGGTKQFPWNSRADKVQAAKNKMDAGFEFMQKMGIEYYCFHDIDLCEEADSIEEYEAN
LKAVVAYAKQKQTETGIKLLWGTANVFSHARYMNGAATNPDFDVVARAAVQIKNAIDATI
ELGGMNYVFWGGREGYMSLLNTDQKREKEHLARMLILARDYARSKGFTGTFLIEPKPMEP
SKHQYDVDTETVIGFLKAHNLDKDFKVNIEVNHATLAGHTFEHELAVAVDNGMLGSIDAN
RGDYQNGWDTDQFPIDNFELIQAMMQIIRNDGLGNGGTNFDAKTRRNSTDLEDIFIAHIA
GMDAMARALENAAKLLEESPYKKMLADRYASFDAGKGKEFEEGRLTLEDVVAYAKANSEP
KQISGKQELYEAIVNMYC
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaaaagagtattttcccggaataggaaaaattaagttcgaaggaaaagagagc
atgaacccaatggcattccgctattacgatgctgaaaaagtggtgatgggaaaaaagatg
aaagattggctgaaatttgccatggcatggtggcataccctctgtgcggaaggtggcgac
caatttggcggtggtacgaagcaattcccttggaacagtcgtgcagacaaagtgcaggcc
gccaagaacaaaatggatgctggctttgagttcatgcagaaaatgggcatcgaatactat
tgtttccacgacatagacctttgcgaagaagccgatagcatcgaagaatacgaagccaac
ctgaaagctgttgtggcatacgccaaacagaaacaaacggaaacaggcatcaaactgctg
tggggtactgccaacgtattcagccatgcacgctacatgaacggtgccgcaaccaatccg
gatttcgacgtagtggcacgtgctgccgttcaaatcaagaacgccatcgacgcaaccatc
gaactaggtggaatgaactatgtattttggggtggacgtgaaggctatatgtcattgctg
aacacggaccaaaaacgtgaaaaggaacaccttgcacggatgttgatccttgcccgcgac
tatgcccgcagcaaaggcttcaccggtacattcctgattgagcccaaaccgatggaaccc
tccaaacatcaatatgacgtggataccgaaaccgtcattggcttcttgaaagctcataat
ctggataaggacttcaaagtgaatatcgaggtgaatcatgctacgttggccggtcatact
tttgaacacgaattagccgtagccgtcgacaacggtatgttgggctccatcgacgccaac
cgtggagactatcagaacggatgggataccgatcaattccctattgataactttgaactg
atacaggccatgatgcaaatcattcgtaacgatggtttgggcaacgggggtacgaacttc
gacgctaagactcgccgtaactcgaccgatttggaagacatcttcattgcgcacattgca
ggcatggacgctatggcacgcgcccttgaaaacgcagccaaactgcttgaagaatctcct
tacaagaagatgctggccgaccgctatgcttctttcgatgccggcaagggcaaggagttc
gaggaaggcagattgacgctggaagatgtggtagcatacgctaaagccaacagcgaacct
aaacagatcagtggcaaacaagagttgtatgaggctatagtaaatatgtattgctaa

DBGET integrated database retrieval system