KEGG   Tannerella forsythia: BFO_2966Help
Entry
BFO_2966          CDS       T01682                                 

Definition
O-Glycosyl hydrolase family 30
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
tfo  Tannerella forsythia
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tfo00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BFO_2966
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BFO_2966
Enzymes [BR:tfo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     BFO_2966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2997519..2998979
Genome map
AA seq 486 aa AA seqDB search
MKKMYQWIYGVFLAGIGMGGCEFQSVETVDLFTTTSDRTKEFAYEIISFHEEGLKDTDLL
ITLDTAVRYQTMDGFGAAITGSTAYNLMRMTPENRSAFLYETFSPDRMGFSYVRISIGCS
DFSLSEYTCCDKKGIEHFSLTAEETIYVIPVLKEILRINPSLKVMGSPWTCPTWMKISDL
KTKLSFRSWTGGHLSPLYYGDYATYFVKWIQAFQKEGIPIYAITPQNEPLNRGNSASLYM
GWREQLAFIKTALGPKFKTAGLKTKIYAFDHNFDYDRMEDQQDYPLHLYADTEASTYIAG
AAYHHYSGDKSELNRIHAAYPNKELMFTEASIGAWNDGRNFRMRLLEDMCEIGLGTVNNH
CKGVIVWNLMLDSRQGPNREGGCQNCYGTVDIDTTDYKTITRNSHYFVIAHLASVVKPGA
VRVGIEGKLPEGVTGSAFLNPNGSYAFVVMNKSSTPCTFFMGESERLIQCHLPGRSIVSY
RWNDKP
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatgtatcaatggatatacggggtattccttgcagggataggaatgggcggt
tgcgaatttcagtctgtagaaacagtcgatctgtttacgacaacgtccgaccgtacgaaa
gaatttgcttatgaaatcatttcgtttcatgaagaaggcttgaaagataccgatctcctc
attacgctcgatacggcggtgcgttatcagacgatggacggtttcggagcagccattaca
ggttcgacagcctataacctgatgcggatgacaccggaaaaccgttcggcttttctatac
gaaacgttctctcccgacaggatggggttcagctatgtacgcatttcgatcggctgctct
gatttttcgctgagtgaatatacgtgttgcgataagaaaggcattgaacacttttcactg
acggccgaagaaacaatatacgtcatccctgtcctaaaagaaattctgcgaatcaatccg
tcattaaaagtgatgggatcgccgtggacttgtccgacttggatgaaaatctccgacctg
aaaacaaagctctctttccgttcatggaccggcggacacctcagtccgctttattacggg
gattatgccacgtatttcgtaaaatggatacaggcatttcagaaagaaggtattccgatc
tatgccattacccctcagaatgaaccgctgaatcgaggaaactcggcttctctgtatatg
ggatggcgtgaacagctggcattcataaaaacggcgctcggcccgaagttcaaaacggcc
ggactgaaaacgaaaatctatgctttcgatcataatttcgattacgatcgaatggaagat
cagcaggattatccgctgcatctctacgccgataccgaggcgtcgacatacattgccgga
gcagcttatcatcattattcgggcgacaaaagtgaactgaaccgcatccatgcggcttac
cccaataaggaactgatgtttaccgaggcctccattggtgcttggaacgacgggcgcaat
ttccggatgcgtctgctcgaagatatgtgcgaaatcgggctgggaacggtgaataaccac
tgtaagggagtcatcgtatggaatctgatgctcgacagcagacaggggcctaaccgtgag
ggaggttgccaaaactgttatggaactgttgatatcgatacaacggattataaaacaatc
actcgcaattcacattatttcgtgattgcacatttggcatcggtcgtgaagcccggagcc
gtacgtgtcggaatcgagggcaaattaccggaaggggttacaggcagtgcttttctgaat
ccaaacggtagctatgccttcgttgtcatgaataaatcttcaaccccctgtacattcttc
atgggcgaaagcgagcgtttgatccagtgtcatctaccgggccgttcaatagtctcctac
cgatggaacgataaaccataa

DBGET integrated database retrieval system