KEGG   Thermobifida fusca: Tfu_0058Help
Entry
Tfu_0058          CDS       T00265                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
tfu  Thermobifida fusca
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:tfu00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
67652..68626
Genome map
AA seq 324 aa AA seqDB search
MREGGNPVSTPIGPTDSSLVPRFAGPATFARLPRTDEVAKTDIAVVGIPFDSGVSYRPGA
RFGPAAIREASRLLRPYNPGLDVSPFAEVQVADGGDIAVNPFAIKEAIATVEASASELLS
QGTRLVTLGGDHTIALPLLRAVHRVHGPVALLHFDAHLDTWDTYFGEPYTHGTPFRRAVE
EGILDTEALTHVGIRGPLYGKKDLEDDRRFGFGIVTAADVMRRGVDEIADMVRQRIGNRP
LYVSVDIDVLDPAHAPGTGTPEAGGLTSRELLELLRGLASCNLVGADVVEVSPAYDHAQI
TATAAAHVAYDLVSLLALTAKKDR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtgagggaaggcggtaatcccgtgagcacaccgatcggtcccaccgactccagcttggtt
ccccggtttgctggtccggcgacttttgcccgactgccccgcaccgatgaggtagccaag
accgatatcgccgtggtcggtatcccgttcgacagcggtgtgtcctaccgtcccggcgcc
cggttcggtcctgctgctatccgtgaggctagtcggctgctgcgcccctacaacccgggg
ttggatgtgtccccgttcgctgaagtccaggtggccgacggcggtgacatcgcggtcaac
ccgttcgcgatcaaggaggccattgcaacggtcgaagcctcagccagcgagttgttgtct
cagggtactcgcttggtgactttgggtggagaccacacgatcgcgttgccgctgctccgc
gccgtgcaccgggtgcacgggccggtggcgctcctgcacttcgacgcccatttggacacg
tgggacacctatttcggtgagccttacacgcacggcaccccgttccgccgtgccgtggag
gaggggattctcgacacggaagccctcacccacgtggggatccgcggccccctctacggc
aagaaggacttggaggacgaccgccggttcggtttcggtatcgtcaccgccgcggacgtg
atgcgccgcggggtggacgagatcgctgacatggtgcggcagcggatcgggaaccggccg
ctatacgtgtccgtggacatcgacgtcctcgacccggcgcacgctcccggcaccggcacc
ccggaggcgggcggcctgaccagccgggaactgttggagctgctgcgtgggctggcctcc
tgcaacctggtgggggccgacgtggtggaggtttcccccgcatacgaccacgcgcagatc
acggcgaccgcggccgcccacgtcgcctacgacttggtgtcccttctcgcgttgaccgcg
aagaaggaccgctag

DBGET integrated database retrieval system