KEGG   Thermobifida fusca: Tfu_0067Help
Entry
Tfu_0067          CDS       T00265                                 

Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
tfu  Thermobifida fusca
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Tfu_0067
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Tfu_0067
   00650 Butanoate metabolism
    Tfu_0067
  Lipid metabolism
   00071 Fatty acid degradation
    Tfu_0067
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Tfu_0067
   00310 Lysine degradation
    Tfu_0067
   00360 Phenylalanine metabolism
    Tfu_0067
   00380 Tryptophan metabolism
    Tfu_0067
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Tfu_0067
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Tfu_0067
   00281 Geraniol degradation
    Tfu_0067
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Tfu_0067
   00627 Aminobenzoate degradation
    Tfu_0067
   00930 Caprolactam degradation
    Tfu_0067
Enzymes [BR:tfu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Tfu_0067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
85575..86345
Genome map
AA seq 256 aa AA seqDB search
MGEFIRFESDGPVRHIVLNAPQRLNALDRPMLAELAEAVRAVAADEEARALVVSGAGRAF
CAGADVTSLFGDPTRPPAVIRDELKQVYASFLSIADLTIPTIAAVGGIAVGAGVNIAMAC
DMVVAGPKAKFAITFAEMGLHPGGGCSWFLTRRMGGHRALATLLDAERIDAEEAFRAGLV
TRLVEDPVAEALAMAHSYAERDPGLVRDMKRAVRMAETADLATVLEFESWAQASSVNSPR
FQEFLAEFAARKNKKE
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgggggagttcatcaggttcgagtcggacggcccggtgcggcacatcgtcctcaatgcg
ccgcagcggctcaacgccctcgaccggccgatgctcgccgagttggccgaggcggtccgc
gcggtcgcggctgatgaggaggcgcgcgccctagtggtcagcggcgcgggccgggcgttc
tgcgcgggcgcggatgtcaccagcctgttcggggatcccacgcgtccgcccgcggtgatc
cgcgacgagttgaagcaggtgtatgcgagctttctcagcattgccgacctgacgattccc
acgatcgccgcggtgggcggtatcgcggtcggtgccggggtgaatattgcgatggcctgc
gacatggtcgtggcgggcccgaaagcgaagtttgcgatcacgttcgctgagatggggctg
cacccgggcggcggctgcagttggttcctcacccggcggatgggcgggcaccgggcgttg
gcgaccctgttggacgcggagcggatcgacgctgaagaggcgttccgcgccggtctggtc
acccggctggtggaggatccggtggctgaagcgctggctatggcccacagctacgccgag
cgtgatcctggcctggtcagggacatgaaacgggcggtgcggatggcggagaccgcggat
ctcgccacggtgttggagttcgagtcgtgggcgcaggcgtcgtcggtgaattcgccgcgt
ttccaggagttcctcgccgagttcgcggcgcggaagaacaagaaggagtga

DBGET integrated database retrieval system