KEGG   Thermobifida fusca: Tfu_0081Help
Entry
Tfu_0081          CDS       T00265                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
tfu  Thermobifida fusca
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Tfu_0081
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Tfu_0081
Enzymes [BR:tfu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Tfu_0081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(101996..102811)
Genome map
AA seq 271 aa AA seqDB search
MTPHDTRPDTAAPPTSAAAGTSVDVDLTGRTALVTGAASGIGRACATRLAAAGATVRLVD
LNREALDELAQRGIGEPHHVDLTDLDAVDTVARGVDIVVNNAGVQTVCPVHEFPPERFSM
MVKLMLEAPFRIVRAALPHMYARNWGRIINISSVHGLRASAYKSAYVAAKHGLEGFSKVV
ALEGAPHGVTSNCINPGYVRTPLVEQQIADQARAHGIPASDVVETVLLARSPIKRLIEPA
EVAEMVAYLCCPEASFINGASLTIDGAWSAS
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgacaccgcatgacactcgtcccgacacggccgcaccccccacctccgctgcggccggg
acctctgttgacgtggacctcaccggccggaccgctctcgtaaccggcgctgccagcggc
atcggccgcgcctgcgcgacccgcctagccgccgccggggccaccgtccgcctcgtcgac
ctcaaccgggaagccctcgacgaactcgcccagcgcggaataggcgaaccccaccacgta
gacctcaccgacctggacgcggtcgacactgtggcacgcggcgtcgacatcgtcgtcaac
aacgctggagtgcagacagtctgccccgtccacgaattccccccggaacgcttctccatg
atggtgaaactcatgctggaagccccgttccggatcgtgcgggccgcgctgccgcacatg
tacgcgcgcaactgggggcggatcatcaacatctcctccgtgcacgggctgcgggcctcc
gcctacaagtccgcctacgtggccgccaaacacggtttggaaggcttctccaaagtcgtc
gccctcgaaggcgccccgcacggagtcacctccaactgcatcaaccccggctacgtgcgc
acccccctcgtggaacagcagatcgccgaccaggcgcgcgcccacgggatccccgccagc
gacgtagtggaaaccgtgctgctggcccgcagccccatcaaacggctcatcgaacccgcc
gaagtcgctgaaatggtggcctacctgtgctgtcccgaggcgtctttcatcaacggcgcc
tccctgaccattgatggagcatggagcgcgagctga

DBGET integrated database retrieval system