KEGG   Thermobifida fusca: Tfu_0178Help
Entry
Tfu_0178          CDS       T00265                                 

Definition
phosphoribosylformylglycinamidine synthase subunit PurS (EC:6.3.5.3)
Orthology
K01952  
phosphoribosylformylglycinamidine synthase [EC:6.3.5.3]
Organism
tfu  Thermobifida fusca
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Tfu_0178
Enzymes [BR:tfu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.3  phosphoribosylformylglycinamidine synthase
     Tfu_0178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(200854..201096)
Genome map
AA seq 80 aa AA seqDB search
MARVIVDVMLKPEILDPQGQAILGACERLGFSGVTQVRQGKRFEIDLEGEADEARLAEIR
KLAETLLANPVIEDFSLRVE
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
gtggcccgcgtcatcgtcgatgtcatgctcaagcccgagatcctggacccccagggccag
gccatcctgggcgcctgcgaacggcttggcttctccggggtgacccaagtccgtcagggc
aagcgcttcgagatcgacctcgagggcgaagccgacgaggcccgtctcgccgaaatccgc
aagctcgccgagaccctgctcgccaacccggttatcgaggatttctcactccgcgtagag
taa

DBGET integrated database retrieval system