KEGG   Thermobifida fusca: Tfu_0226Help
Entry
Tfu_0226          CDS       T00265                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tfu  Thermobifida fusca
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tfu_0226
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tfu_0226
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Tfu_0226
Enzymes [BR:tfu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Tfu_0226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
254958..256244
Genome map
AA seq 428 aa AA seqDB search
MRGERLMALTATESVTSATGSFGSASALSCRECGARYDLGPIFACIECFGPLEVAYDFGT
VTRESIEQGPKNIWRYKALLPVPVDVEKLPNMNPGLTPLVKADRLAAELGLRSLYVKDDS
ANPTHSFKDRVVAMAVEAARVFGFTTLSCSSTGNLAGAVGAAAARAGFRSCVFIPAGLEE
AKVVMAAVYGGQLVAIEGTYDDVNRFCSELIGDPAGEDWGFVNVNLRPYYAEGSKTLAYE
IAEQLGWRVPDQIVIPIASGSQLTKIDKGFQELIALGLVEDKPYRIFGAQATGCAPVARA
WEKGYTVVQPVKPDTIAKSLAIGNPADGPYVLDVCRRTGGAVEHVSDEEIVDSIRLLART
EGIFAETAGGVTTGVLRKLLAKGVLDPEAETVVLNTGDGLKTLNAVSGTGVTATIKPSLS
AFKDAGLL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaggggagaacgcctcatggcgctgaccgccacggaatcagtcacgtctgccaccggc
tctttcggttctgcttccgcactgtcgtgccgcgaatgcggcgcccgctacgatctcggt
ccgattttcgcctgcatcgagtgtttcggcccgctggaagtcgcctacgacttcggaacc
gttacccgtgagtccatcgagcaggggccgaagaacatctggcggtacaaggccctgctg
ccggttcccgtcgacgtcgagaagctgccgaacatgaaccccggcctgaccccgctggtc
aaggccgaccggctcgccgctgaactggggctgcgctccctgtacgtcaaagacgactcc
gctaacccgacgcattcgttcaaggaccgggtcgtggccatggcagtggaagctgcccgg
gtcttcggtttcaccaccctgtcctgctcgtcgacagggaaccttgccggggcggtgggc
gctgccgcggcccgcgccgggttccgctcctgcgtgttcatcccggcagggctggaggaa
gccaaggtcgtcatggccgcggtctacggtggccagcttgtggcgatcgagggcacctat
gacgacgtcaaccggttctgctccgagctgatcggcgacccggcgggggaggactggggt
tttgtcaacgtcaacctgcgcccctactacgccgaagggtcgaagacgctcgcctacgag
atcgccgaacagttggggtggcgcgtccccgaccagatcgtgatccccattgcctccggg
tcccagctcaccaagatcgacaagggattccaggagttgatcgcgctggggctggtcgag
gacaagccgtaccggatcttcggggcgcaggcgaccggctgcgcgcccgtggcccgtgcc
tgggagaagggctacaccgtggtccagccggtcaagccggacaccatcgctaagtcgctg
gctatcggcaacccggcggacggcccgtacgtgctcgacgtctgccgccgcacgggaggc
gcggtcgaacacgtcagcgacgaggagatcgtggattcgatccgcctgctggcgcgcacg
gaggggatcttcgccgagactgcgggcggggtcaccactggtgtgctgcgcaaactgctg
gccaagggagtgctggaccccgaggccgagaccgtggtgctcaacaccggggacggcttg
aagacgctcaacgctgtgtccggtaccggtgtcaccgcgacgatcaagccgtcgctgagc
gcgttcaaagacgccgggctgctctga

DBGET integrated database retrieval system