KEGG   Thermobifida fusca: Tfu_0259Help
Entry
Tfu_0259          CDS       T00265                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tfu  Thermobifida fusca
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Tfu_0259
Enzymes [BR:tfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Tfu_0259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
290106..290993
Genome map
AA seq 295 aa AA seqDB search
MAPRIAVFGSVNMDLVAYVDTPPARGETVQGRQFSQVPGGKGANQAIAAARAGADVVFLG
AVGDDVFGPQLRATLVDNGIDVSGLRTVGGASGIAHIVVDREGNNSIIVIPGANGTVTGL
RENDTLLLDGAQALLLQLETPLSGVIAAARAGRSLGVTTVLTPAPAQPLPQELLECVDVL
LPNQYEAATITGEDTPERALAALLETVPEVIITLGSRGALYGARDREPLWVPVVQVEAVD
TTGAGDTFCGAYAVARTEGQDPESALRFAAKAAALSVRIPGASTSMPTRAEIDAF
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtggcaccgcggatcgcagtcttcggcagcgtcaacatggacctggtggcctacgtggac
accccgcccgcccggggggagaccgtccagggacggcagttcagccaggttcctggcggc
aagggcgccaaccaggcgatcgccgcagcacgggccggggcggacgtggtcttcctgggc
gcggtgggcgacgacgttttcggccctcaactgcgcgccaccctggtcgacaacggcatc
gacgtctccgggctgcgcacagtcgggggcgcttccggaatcgcccacatcgtcgtggac
cgggaggggaacaactcgatcatcgtcatcccgggtgctaacggcacggtcaccgggctg
cgggagaacgacaccctgctgttggacggcgcccaggcgctgctgctgcagttggagacg
ccgctgtccggggtgattgcggcggctcgggcgggtcgttcactcggggtgaccacggta
ctgacgcctgccccggcgcagccgctcccccaggagctgttggagtgcgtcgacgtcctc
ctgcccaaccagtacgaggcagcgacgatcaccggcgaggacaccccggagcgggcactg
gccgcgctcttggagaccgtgcccgaggtgatcatcacgttgggcagcaggggtgcgctc
tacggggcccgggaccgcgaacccctgtgggtcccggtggtccaggtggaggccgtcgac
acgaccggggcaggggacacgttctgcggggcgtatgcggtggctcggaccgagggccag
gacccggagtcggcgctgcggttcgccgcgaaagcggccgctttgtcggtgcggattcct
ggggcgagcacgtcgatgcctacccgggccgagatcgacgcgttctga

DBGET integrated database retrieval system