KEGG   Thermobifida fusca: Tfu_0273Help
Entry
Tfu_0273          CDS       T00265                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tfu  Thermobifida fusca
Pathway
tfu00010  Glycolysis / Gluconeogenesis
tfu00052  Galactose metabolism
tfu00500  Starch and sucrose metabolism
tfu00520  Amino sugar and nucleotide sugar metabolism
tfu00521  Streptomycin biosynthesis
tfu01100  Metabolic pathways
tfu01110  Biosynthesis of secondary metabolites
tfu01120  Microbial metabolism in diverse environments
tfu01130  Biosynthesis of antibiotics
tfu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tfu_0273
   00052 Galactose metabolism
    Tfu_0273
   00500 Starch and sucrose metabolism
    Tfu_0273
   00520 Amino sugar and nucleotide sugar metabolism
    Tfu_0273
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tfu_0273
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Tfu_0273
Enzymes [BR:tfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Tfu_0273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Ubiq_cyt_C_chap
Motif
Other DBs
NCBI-ProteinID: AAZ54311
JGI: Tfu0273
UniProt: Q47TA6
Position
complement(304625..305710)
Genome map
AA seq 361 aa AA seqDB search
MVFTRTTGRRTRGLVIGIDIGGTKVAGGVVTPAGHVLDRIRTETPDRSKSPKIVEDTIVD
VVEQLRRDHRIQAVGIGAAGFVDARRSTVLFAPHLSWRDEPLREALQDRLGLPVIVENDA
NAAAWAETRFGAGRGVRDAVVVNLGTGIGGAIIIDGALRRGRYGLAGEFGHMVVVPDGHR
CECGNRGCWEQYASGNALTREARELAAAHSPMASRLLDAAGGDPAQITGPLVTALAREGD
RACIELLEDLGAWLGAGLANLAAAFDPELFIIGGGVCEADELLLAPARAHFHRALTGRGH
RPEARIVRAALGNDAGLIGAADLARSLPLRGLRLPGGAARSRLFFRPPGPRPRRSGVRGV
D
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtggtcttcacgcgaacaactggacgccgcacacgcggactcgtcatcggcatcgacatc
ggaggtacgaaagtcgcgggaggtgtcgtcacccccgccggacacgtactggaccggata
cgcacagaaaccccagaccgcagcaaaagccccaaaatcgtcgaagacaccatcgtcgac
gtcgtcgaacagttacgccgcgaccatcgcatccaggcagtcggcatcggcgccgccgga
ttcgtcgacgcacggcgctccactgtcctcttcgcccctcacctgtcctggcgcgatgaa
ccgttgcgggaagcgctccaggaccggctcgggcttcccgtcatcgtggagaacgacgcc
aacgccgcagcatgggccgaaacccgcttcggcgctggacgcggcgtccgcgatgccgtc
gtggtgaacctcggcaccggcatcggcggagccatcatcatcgacggcgcactgcggcgc
ggccgctacgggctggctggagagttcggccacatggttgtcgtgcccgacgggcaccgc
tgcgaatgcggcaaccggggctgctgggaacagtacgccagcggcaacgcgctgacccgg
gaggcccgggaactcgccgcggcgcattcgcccatggcttcccgcctgctcgacgcggca
ggcggcgaccccgcccagatcactgggccgctggtcaccgccctcgcccgtgaaggcgac
cgcgcctgcatcgaactcttggaagacctcggcgcctggctcggcgccggactagcaaac
ctcgccgcggcgttcgacccggaactgttcatcatcggcggcggggtgtgcgaagccgac
gaactgctgctcgctccggcgcgcgcccacttccaccgcgcgctcaccggccgcggccat
cggcccgaagcccggatcgtgcgggccgctctcggcaacgacgccgggctgatcggcgcc
gctgacctggcccgcagccttcccctccgcgggctccggctgccgggaggtgcggcgcgg
tcccggctcttcttccgcccgccgggaccgcgaccgcggcggtcaggggtgcggggtgtc
gactag

DBGET integrated database retrieval system