KEGG   Thermobifida fusca: Tfu_0373Help
Entry
Tfu_0373          CDS       T00265                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tfu  Thermobifida fusca
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Tfu_0373
   00052 Galactose metabolism
    Tfu_0373
   00500 Starch and sucrose metabolism
    Tfu_0373
   00520 Amino sugar and nucleotide sugar metabolism
    Tfu_0373
Enzymes [BR:tfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Tfu_0373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
418136..419065
Genome map
AA seq 309 aa AA seqDB search
MTDEQHSVTPVTKAVIPVAGLGTRFLPATKSTPKEMLPIVDKPAIQYVVEEAVSAGLNDI
LMITGRNKRSIEDHFDRAYELEEALRAKGDIERLNAVRHPSDLAQLHYVRQGEPRGLGHA
VLCGAAHVGNEPFAVLLGDDLIGARETLLQRMIEVRQTYGGSVIALMEVEPDQVSLYGCA
AIEPTDEPDVVTVTDLVEKPPADQAPSRWAIIGRYICDPEIFEVLRKTPPGRGGEIQLTD
ALRELAQRSSNGGGRVHGVLFRGQRFDTGNKLDYLRTVVEFACESPDLAKEFVPWLRDFL
TRYATDSTR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgacagatgaacagcactctgtaactccggtgaccaaagcggtcattcccgtggcagga
ctggggacgagattcctccccgccactaagtccacgcccaaagagatgctgccgatcgtc
gacaagccggcgatccagtacgtagtggaggaggcggtctccgccgggctcaacgacatc
ctcatgatcaccgggcgcaacaagcgttccatcgaggaccacttcgaccgggcctacgaa
ctggaggaggccctccgcgccaaaggtgacatcgaacggctcaacgcggtgcgccacccc
agtgacctcgcccaactgcactacgtgcggcaaggggaaccgcgcggcctggggcacgcg
gtgctgtgcggcgccgcccacgtgggcaacgagccgttcgcggtcctgctcggcgacgac
ctcatcggcgcgcgggaaaccctgctgcagcggatgatcgaggtccgccagacctacggg
ggcagcgtcatcgccctgatggaggtggaacccgaccaggtctcgctgtacgggtgcgcc
gcgatcgaacccaccgacgagcccgacgtcgtgaccgtcaccgacctcgtcgagaagcct
ccggcggaccaggcgcccagccgctgggcgatcatcggccgctacatctgcgacccggag
atcttcgaagtgctgcgcaagaccccgccgggacgcggcggggagatccagttgaccgac
gcgctccgggaactcgcccagcgcagctccaatgggggaggaagggtccacggtgtgctt
ttccgcggtcaacgcttcgataccgggaacaagcttgactaccttcgcaccgtggtggag
ttcgcctgtgagagtccggatcttgccaaggagttcgtgccgtggctgcgtgacttcctg
acgaggtatgcgacagactccaccaggtaa

DBGET integrated database retrieval system