KEGG   Thermobifida fusca: Tfu_0373Help
Entry
Tfu_0373          CDS       T00265                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tfu  Thermobifida fusca
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:tfu00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tfu00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tfu00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tfu00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
418136..419065
Genome map
AA seq 309 aa AA seqDB search
MTDEQHSVTPVTKAVIPVAGLGTRFLPATKSTPKEMLPIVDKPAIQYVVEEAVSAGLNDI
LMITGRNKRSIEDHFDRAYELEEALRAKGDIERLNAVRHPSDLAQLHYVRQGEPRGLGHA
VLCGAAHVGNEPFAVLLGDDLIGARETLLQRMIEVRQTYGGSVIALMEVEPDQVSLYGCA
AIEPTDEPDVVTVTDLVEKPPADQAPSRWAIIGRYICDPEIFEVLRKTPPGRGGEIQLTD
ALRELAQRSSNGGGRVHGVLFRGQRFDTGNKLDYLRTVVEFACESPDLAKEFVPWLRDFL
TRYATDSTR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgacagatgaacagcactctgtaactccggtgaccaaagcggtcattcccgtggcagga
ctggggacgagattcctccccgccactaagtccacgcccaaagagatgctgccgatcgtc
gacaagccggcgatccagtacgtagtggaggaggcggtctccgccgggctcaacgacatc
ctcatgatcaccgggcgcaacaagcgttccatcgaggaccacttcgaccgggcctacgaa
ctggaggaggccctccgcgccaaaggtgacatcgaacggctcaacgcggtgcgccacccc
agtgacctcgcccaactgcactacgtgcggcaaggggaaccgcgcggcctggggcacgcg
gtgctgtgcggcgccgcccacgtgggcaacgagccgttcgcggtcctgctcggcgacgac
ctcatcggcgcgcgggaaaccctgctgcagcggatgatcgaggtccgccagacctacggg
ggcagcgtcatcgccctgatggaggtggaacccgaccaggtctcgctgtacgggtgcgcc
gcgatcgaacccaccgacgagcccgacgtcgtgaccgtcaccgacctcgtcgagaagcct
ccggcggaccaggcgcccagccgctgggcgatcatcggccgctacatctgcgacccggag
atcttcgaagtgctgcgcaagaccccgccgggacgcggcggggagatccagttgaccgac
gcgctccgggaactcgcccagcgcagctccaatgggggaggaagggtccacggtgtgctt
ttccgcggtcaacgcttcgataccgggaacaagcttgactaccttcgcaccgtggtggag
ttcgcctgtgagagtccggatcttgccaaggagttcgtgccgtggctgcgtgacttcctg
acgaggtatgcgacagactccaccaggtaa

DBGET integrated database retrieval system