KEGG   Thermobifida fusca: Tfu_0373Help
Entry
Tfu_0373          CDS       T00265                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tfu  Thermobifida fusca
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Tfu_0373
   00052 Galactose metabolism
    Tfu_0373
   00500 Starch and sucrose metabolism
    Tfu_0373
   00520 Amino sugar and nucleotide sugar metabolism
    Tfu_0373
Enzymes [BR:tfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Tfu_0373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
418136..419065
Genome map
AA seq 309 aa AA seqDB search
MTDEQHSVTPVTKAVIPVAGLGTRFLPATKSTPKEMLPIVDKPAIQYVVEEAVSAGLNDI
LMITGRNKRSIEDHFDRAYELEEALRAKGDIERLNAVRHPSDLAQLHYVRQGEPRGLGHA
VLCGAAHVGNEPFAVLLGDDLIGARETLLQRMIEVRQTYGGSVIALMEVEPDQVSLYGCA
AIEPTDEPDVVTVTDLVEKPPADQAPSRWAIIGRYICDPEIFEVLRKTPPGRGGEIQLTD
ALRELAQRSSNGGGRVHGVLFRGQRFDTGNKLDYLRTVVEFACESPDLAKEFVPWLRDFL
TRYATDSTR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgacagatgaacagcactctgtaactccggtgaccaaagcggtcattcccgtggcagga
ctggggacgagattcctccccgccactaagtccacgcccaaagagatgctgccgatcgtc
gacaagccggcgatccagtacgtagtggaggaggcggtctccgccgggctcaacgacatc
ctcatgatcaccgggcgcaacaagcgttccatcgaggaccacttcgaccgggcctacgaa
ctggaggaggccctccgcgccaaaggtgacatcgaacggctcaacgcggtgcgccacccc
agtgacctcgcccaactgcactacgtgcggcaaggggaaccgcgcggcctggggcacgcg
gtgctgtgcggcgccgcccacgtgggcaacgagccgttcgcggtcctgctcggcgacgac
ctcatcggcgcgcgggaaaccctgctgcagcggatgatcgaggtccgccagacctacggg
ggcagcgtcatcgccctgatggaggtggaacccgaccaggtctcgctgtacgggtgcgcc
gcgatcgaacccaccgacgagcccgacgtcgtgaccgtcaccgacctcgtcgagaagcct
ccggcggaccaggcgcccagccgctgggcgatcatcggccgctacatctgcgacccggag
atcttcgaagtgctgcgcaagaccccgccgggacgcggcggggagatccagttgaccgac
gcgctccgggaactcgcccagcgcagctccaatgggggaggaagggtccacggtgtgctt
ttccgcggtcaacgcttcgataccgggaacaagcttgactaccttcgcaccgtggtggag
ttcgcctgtgagagtccggatcttgccaaggagttcgtgccgtggctgcgtgacttcctg
acgaggtatgcgacagactccaccaggtaa

DBGET integrated database retrieval system