KEGG   Thermobifida fusca: Tfu_0407Help
Entry
Tfu_0407          CDS       T00265                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
tfu  Thermobifida fusca
Pathway
tfu00900  Terpenoid backbone biosynthesis
tfu01100  Metabolic pathways
tfu01110  Biosynthesis of secondary metabolites
tfu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Tfu_0407
Enzymes [BR:tfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Tfu_0407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AAZ54445
JGI: Tfu0407
UniProt: Q47SX2
Position
458401..459324
Genome map
AA seq 307 aa AA seqDB search
MNAPTSVTVRVPAKVNLRLAVGPVRGDGYHGLVNVFHAVSLYDEVTVSPRSDLAPGQAVL
SVDGERPDHVARVPLDDSNLAARAAALLARHVPHATGVHIHVHKAIPVAGGMAGGSADAA
AALVACDALWEGGTPRERLLELAAELGSDVAFPLIGCTAVGTGRGEQLSPLPVQGTFHWV
FALVDGGLSTTKVFAEYDRLRPDAPEPTLDDALVAALAAGDARRLGAALTNDLQPAALAL
RPELGDLLEAGRAAGALGALVSGSGPTCAFLAESADHARELAAALRASGTCADTVTAHGP
VPGATVV
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgccccgacttccgtcaccgtgcgggtccccgcgaaggtgaacttgcggcttgcc
gtggggccggtccgcggcgatggataccacggcttggtcaacgtcttccacgcggtctcg
ctctacgacgaggttaccgtttctccccgctccgaccttgcgcccggacaggcggtgctc
agtgtggacggggagcgaccggaccacgtggcccgcgtgcccctcgacgacagcaacctc
gcggcgcgcgccgccgccctgctggcccgccacgtgccccacgccaccggggtgcacatc
cacgtgcacaaggccattcctgtggccggtggcatggctgggggaagcgctgatgcggct
gccgcgctcgtggcgtgcgatgcgctctgggaaggcggcaccccccgcgagcggctgctg
gagctggccgcagagctcggcagcgacgtcgccttcccgttgatcggctgcaccgcggtg
ggcaccgggcgcggcgagcagctctccccgctccccgtccaggggacgttccactgggtg
ttcgccctcgtcgacgggggcctgtccacgacgaaagtattcgcggaatacgaccggctg
cgaccggacgcccccgagcccacgctcgacgacgcgctagtcgccgcgctcgccgccggg
gacgcccgtcggctgggtgcggcactcaccaacgacctccagccagccgccttggcgctc
cgccccgaactgggggacctccttgaggcgggccgtgccgcgggagcgctgggcgccctc
gtgtccggctccggacccacgtgtgcgttcctcgccgagtcggcggaccacgcccgcgag
cttgccgctgccttgcgcgcgagcggcacgtgtgcggacacggtgaccgcccacggcccg
gtccccggcgccaccgtggtgtag

DBGET integrated database retrieval system