KEGG   Thermobifida fusca: Tfu_0443Help
Entry
Tfu_0443          CDS       T00265                                 

Definition
(GenBank) magnesium chelatase subunit ChlI
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
tfu  Thermobifida fusca
Pathway
tfu00860  Porphyrin and chlorophyll metabolism
tfu01100  Metabolic pathways
tfu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Tfu_0443
Enzymes [BR:tfu01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Tfu_0443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase Sigma54_activat AAA_5 AAA_PrkA AAA_3 AAA_16 ABC_tran MCM AAA_22 NACHT
Motif
Other DBs
NCBI-ProteinID: AAZ54481
JGI: Tfu0443
UniProt: Q47ST6
Position
complement(502827..504254)
Genome map
AA seq 475 aa AA seqDB search
MNRLEGVPDHVDLPHTLGALRASGHRYRSVKDEIRENLLHRIRSGEERFPGIVGFSETVL
PQLERALLARHDVVLLGERGQGKTRLIRTLTGLLDEWSPAVAGCALNDHPYAPVSPQARR
MVAEYGDDLPIVWRHRDERYSEKLATPDTSVGDLIGDIDPVKLAEGRSLGDPETVHYGLV
PRSNRGVFCLNELPDLAARVQVALFNVLEERDVQIRGYQLRLPLDMLVVASANPEDYTNR
GRIITPLKDRFGAEIRTHYPVELDDEIALIEQESRLSPEVRVPPHLVEAVARFTRLVRES
PSVDERSGVSARFAIAAVETVAASAERRAAMTGEQAVARVCDLPCITAVLRGKVEFDLSE
EGRENAVLEHLLNRAVYDTFRRVFSGVDLGPLTERFSSGAAVESGDLVSAEELLARVGPF
TGLAELVKRVAPDSDDDPVSAPGYAAAAVELALEGLYLSRRLSKDTLPHGARYRI
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
gtgaatagactcgaaggtgtgcccgatcacgtcgaccttccgcacaccctgggcgcgttg
cgcgcttcggggcaccgctaccggtcagtcaaagacgaaatccgcgaaaatctcctgcat
cggatccggtcgggggaggaacgcttccccgggatcgtggggttctctgaaaccgtactg
ccgcaactcgaacgggccctccttgcccggcatgacgtggtgctcctgggtgaacgtggc
cagggaaagacacggctgatccgtacactcacgggtctgctggacgagtggagcccggcc
gtggcgggctgcgcgctcaacgaccacccctacgcgccggtctcccctcaagcccgtcgg
atggtcgctgaatacggcgacgacctgcctatcgtgtggcggcaccgcgacgagcggtac
agcgagaagctggcgacccccgacaccagcgtcggcgacctcatcggcgacatcgacccg
gtcaaactcgcggaagggcgtagcctcggcgacccggagacggtgcactacggcctggta
ccgaggtcgaaccggggcgtgttctgcctcaacgagctgcccgacctggccgcgcgcgtc
caggttgcgctgttcaacgtgcttgaagagcgggacgtgcagatccgcggctaccagttg
cggctgccgttggacatgctcgtggtggcgagcgccaacccggaggactacaccaaccgg
ggccggatcatcaccccgctcaaggaccggttcggcgcggagatccgcacccactacccg
gtggagctcgacgacgagatcgccctgatcgaacaggagagccggctgtcgccggaggtg
cgtgtccccccgcacctggtggaagcggtcgcccggttcacccggctggtgcgcgagtcc
ccgtccgtggatgaacgctccggggtgtcggcccggttcgcgatcgccgcagtggagacg
gtggctgcctccgcggagcgccgtgccgcgatgactggcgagcaggcggtggcgcgggtc
tgtgacctgccgtgcattacggcggtgctgcgcggcaaggtggagttcgacctgtccgag
gagggccgggagaacgcggtcttggagcacttgctgaaccgcgccgtctacgacacgttc
cgtcgtgtcttcagcggagtggacttgggaccgctcaccgagcgcttctcctccggtgcg
gccgtggagtcgggggatctggtgagtgcggaagagctcctcgcacgggtgggcccgttc
accgggctggcggagctcgtcaagcgggtcgccccggacagcgacgacgatccggtgtcg
gctcccggctatgcggcggccgcggtggaactcgcgttggagggcctgtatttgagccgg
aggctgtcgaaggacacgctgccgcacggggcccggtaccggatctga

DBGET integrated database retrieval system