KEGG   Thermobifida fusca: Tfu_0747Help
Entry
Tfu_0747          CDS       T00265                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
tfu  Thermobifida fusca
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Tfu_0747
Enzymes [BR:tfu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Tfu_0747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
880259..881473
Genome map
AA seq 404 aa AA seqDB search
MPRRVVILGSTGSIGTQAIEVVRQEPHRFDVVGLAAGGGRLDLLADQACALDVQAVAVAD
AVKAAELRDKLSARGSAAKVLAGPEGVAELAAWDCDVVLNGITGALGLESTLAALRAGRL
LALANKESLIIGGPLVRELAVPGQIVPVDSEHYAIAQCFPRLPADQLTSLAQGNLAARRD
HVRRLVITASGGPFRGRSSAELADVTPEQALAHPTWRMGPVITINSATLVNKGLEVIEAH
LLFDIPFEQIEVVVHPQSVIHSMVEYVDGSTIAQASPPSMRIPIAYGIAWPDRVPEAAPA
IDWTRAHQWTFEPLDHEAFPAVRLACEVGSVGGTAPAVYNAANEEAVAAFLAGRLAFPAI
LDTVARVVSEHRGESRGTVPRLEDVYEADDWARQRAKELISRQG
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgccacgcagagtcgtcatcctcggctccaccggatcgatcggcacccaagccatcgag
gtggtccggcaagaaccccaccgcttcgacgtagtcggactcgccgctggcggcggacgc
ctcgacctgctcgccgaccaagcctgcgccctcgacgtccaagccgtcgcggtcgccgac
gccgtcaaagccgctgaactgcgcgacaagctctccgcacggggcagtgccgccaaagtc
ctagccggacccgaaggagtcgcggagctcgccgcctgggactgcgacgtggtgctcaac
ggcatcaccggggcgctcggcctggaatccaccctcgctgcgctgcgcgccggacggctg
ctcgcccttgccaacaaagaatcgctgatcatcggcggcccgctcgtccgggagctcgcc
gtccccggacagatcgtgcccgtggactccgagcactacgcgatcgcccagtgcttcccc
cgcctgcccgccgaccagctcaccagcctggcgcaaggcaacctcgccgcccgccgcgac
cacgtgcgccgcctcgtcatcaccgccagcggcggaccgttccgcggccgctcctccgcc
gagctcgccgacgtcacccccgagcaggcgctcgcccaccccacgtggcgcatgggcccg
gtcatcaccatcaactccgcgaccctggtcaacaaagggctggaagtcatcgaagcgcac
ctgctcttcgacatccccttcgaacagatcgaggtcgtcgtccacccgcagtcggtcatc
cactcgatggtggagtacgtcgacggctccaccatcgcccaggcgagcccgcccagcatg
cgcatccccatcgcctacggcatcgcctggccggaccgggtcccggaagccgctcccgcc
atcgactggacccgggcccaccagtggaccttcgaacccctcgaccacgaggcgttcccc
gccgtgcggctggcctgcgaagtcggatctgtgggcgggaccgcgccggccgtgtacaac
gccgccaacgaggaggccgtcgccgctttcctcgccgggcgtctggcatttccggcgatc
ctggacaccgtggcgcgggtagtctcagaacaccggggagagagccgagggactgtgccg
cggctcgaagacgtctacgaagccgacgactgggcccgacaacgggccaaggagctcatc
tcccggcagggatga

DBGET integrated database retrieval system