KEGG   Thermobifida fusca: Tfu_0811Help
Entry
Tfu_0811          CDS       T00265                                 

Definition
(dimethylallyl)adenosine tRNA methylthiotransferase
Orthology
K06168  
bifunctional enzyme involved in thiolation and methylation of tRNA
Organism
tfu  Thermobifida fusca
Brite
Transfer RNA biogenesis [BR:tfu03016]
 Prokaryotic Type
  tRNA modification factors
   Methylthiotransferase
    Tfu_0811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
958055..959539
Genome map
AA seq 494 aa AA seqDB search
MSQSRTYQVRTYGCQMNVHDSERLSGLLEAAGYQRAAEGTTPDVVVFNTCAVRENADNRL
YGNLGQLRPVKDANPDMQIAVGGCLAQKDRGEIIRRAPWVDVVFGTHNIGSLPALLERAR
VQREAQVEIVESLERFPSTLPTRRESVYAAWVAISVGCNNTCTFCIVPALRGKEKDRRPG
DILAEIRAVVAEGAIEVTLLGQNVNAYGSEFGDRQAFSKLLRACGEIEGLERVRFTSPHP
RDFTDDVIAAMAETPNVMPQLHMPLQSGSDRILRAMRRSYRAERFLRIVEKVREAIPDAA
ITTDVIVGFPGETEEDFAETLRVMEEVRFAHAFTFQYSKRPGTPAASMDNQVPREVVKER
YQRLLELQERISEEENAKFVGREVEVLVAEGEGRKDDVHRRMSGRARDNRLVHFAVDEGV
TVRPGDMVTVEVTYAAPHHLVADSGIRNLRRTRAGDAWEARNAPERRPTGVLLGMPKVGA
PEPQPSVVGGCCDS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
gtgagccagagtcgtacctaccaagtgcggacctacggctgccagatgaacgtccacgac
tccgaacggctctccggactgctggaggccgcggggtaccagcgggcagccgaaggcacc
acgccggatgtcgttgttttcaacacctgtgcggtgcgtgagaacgcggataaccgcctc
tacggcaacctaggccagttgcggccggtcaaggatgccaacccggacatgcagatcgcg
gtgggcgggtgcctggcgcagaaggaccgcggggagatcattcgccgcgccccctgggtc
gacgtggtcttcgggacgcacaacatcggctcgctgcccgcattgctggaacgcgcccgc
gtgcagcgggaagcccaagtggagatcgtcgagtcgttggagcggttcccctccacgctg
cccacccggcgcgagtcggtgtacgcggcgtgggtggcgatctcggtgggctgcaacaac
acgtgcacgttctgtatcgttccggcgctgcgcggcaaggagaaggaccgccgccccggc
gacattttggcggagatccgcgcggtcgtggccgaaggggcgatcgaggtcaccctgctg
gggcagaacgtcaacgcctacggttcggagttcggcgaccggcaggcgttctccaaactg
ctgcgggcctgcggtgagatcgaaggattggagcgggtgcggttcacctccccccacccg
cgtgatttcaccgacgacgtgattgcagcgatggcggagacccccaatgtgatgccgcag
ttgcacatgccgctgcagtcgggttctgaccggattctgcgggcgatgcgccgctcctac
cgggccgagcggttcctgcggatcgtggagaaggtgcgggaagcgatcccggacgcggcg
atcaccaccgacgtgatcgtcgggttccccggggagaccgaggaggacttcgccgagacc
ttgcgggtgatggaggaggtgcggttcgcgcacgccttcaccttccagtactccaagcgc
ccgggcactccggcggcgtcgatggacaaccaggtgccccgagaagtggtgaaagagcgc
taccagcggctcttggagctgcaggagcgtatctccgaggaggagaacgccaagttcgtg
ggccgcgaagtggaggttctggtcgccgagggcgagggccgcaaggacgatgtgcaccgt
cgcatgtcgggccgggcccgtgacaaccgcctcgtgcatttcgcggtggacgagggtgtg
acggtacgccccggcgacatggtcacggtggaggtgacgtacgcggcgccccaccacctg
gtggcggattcggggattcggaacctgcggcgcacccgcgccggcgacgcgtgggaggcg
cgcaacgccccagagcggcggcctaccggggtgctgctgggcatgccgaaggtgggggcg
ccggagccgcagccgagcgtggtgggcggctgctgcgattcttga

DBGET integrated database retrieval system