KEGG   Thermobifida fusca: Tfu_0811Help
Entry
Tfu_0811          CDS       T00265                                 

Definition
(dimethylallyl)adenosine tRNA methylthiotransferase
Orthology
K06168  
bifunctional enzyme involved in thiolation and methylation of tRNA
Organism
tfu  Thermobifida fusca
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
958055..959539
Genome map
AA seq 494 aa AA seqDB search
MSQSRTYQVRTYGCQMNVHDSERLSGLLEAAGYQRAAEGTTPDVVVFNTCAVRENADNRL
YGNLGQLRPVKDANPDMQIAVGGCLAQKDRGEIIRRAPWVDVVFGTHNIGSLPALLERAR
VQREAQVEIVESLERFPSTLPTRRESVYAAWVAISVGCNNTCTFCIVPALRGKEKDRRPG
DILAEIRAVVAEGAIEVTLLGQNVNAYGSEFGDRQAFSKLLRACGEIEGLERVRFTSPHP
RDFTDDVIAAMAETPNVMPQLHMPLQSGSDRILRAMRRSYRAERFLRIVEKVREAIPDAA
ITTDVIVGFPGETEEDFAETLRVMEEVRFAHAFTFQYSKRPGTPAASMDNQVPREVVKER
YQRLLELQERISEEENAKFVGREVEVLVAEGEGRKDDVHRRMSGRARDNRLVHFAVDEGV
TVRPGDMVTVEVTYAAPHHLVADSGIRNLRRTRAGDAWEARNAPERRPTGVLLGMPKVGA
PEPQPSVVGGCCDS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
gtgagccagagtcgtacctaccaagtgcggacctacggctgccagatgaacgtccacgac
tccgaacggctctccggactgctggaggccgcggggtaccagcgggcagccgaaggcacc
acgccggatgtcgttgttttcaacacctgtgcggtgcgtgagaacgcggataaccgcctc
tacggcaacctaggccagttgcggccggtcaaggatgccaacccggacatgcagatcgcg
gtgggcgggtgcctggcgcagaaggaccgcggggagatcattcgccgcgccccctgggtc
gacgtggtcttcgggacgcacaacatcggctcgctgcccgcattgctggaacgcgcccgc
gtgcagcgggaagcccaagtggagatcgtcgagtcgttggagcggttcccctccacgctg
cccacccggcgcgagtcggtgtacgcggcgtgggtggcgatctcggtgggctgcaacaac
acgtgcacgttctgtatcgttccggcgctgcgcggcaaggagaaggaccgccgccccggc
gacattttggcggagatccgcgcggtcgtggccgaaggggcgatcgaggtcaccctgctg
gggcagaacgtcaacgcctacggttcggagttcggcgaccggcaggcgttctccaaactg
ctgcgggcctgcggtgagatcgaaggattggagcgggtgcggttcacctccccccacccg
cgtgatttcaccgacgacgtgattgcagcgatggcggagacccccaatgtgatgccgcag
ttgcacatgccgctgcagtcgggttctgaccggattctgcgggcgatgcgccgctcctac
cgggccgagcggttcctgcggatcgtggagaaggtgcgggaagcgatcccggacgcggcg
atcaccaccgacgtgatcgtcgggttccccggggagaccgaggaggacttcgccgagacc
ttgcgggtgatggaggaggtgcggttcgcgcacgccttcaccttccagtactccaagcgc
ccgggcactccggcggcgtcgatggacaaccaggtgccccgagaagtggtgaaagagcgc
taccagcggctcttggagctgcaggagcgtatctccgaggaggagaacgccaagttcgtg
ggccgcgaagtggaggttctggtcgccgagggcgagggccgcaaggacgatgtgcaccgt
cgcatgtcgggccgggcccgtgacaaccgcctcgtgcatttcgcggtggacgagggtgtg
acggtacgccccggcgacatggtcacggtggaggtgacgtacgcggcgccccaccacctg
gtggcggattcggggattcggaacctgcggcgcacccgcgccggcgacgcgtgggaggcg
cgcaacgccccagagcggcggcctaccggggtgctgctgggcatgccgaaggtgggggcg
ccggagccgcagccgagcgtggtgggcggctgctgcgattcttga

DBGET integrated database retrieval system