KEGG   Thermobifida fusca: Tfu_0901Help
Entry
Tfu_0901          CDS       T00265                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
tfu  Thermobifida fusca
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Tfu_0901
Enzymes [BR:tfu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Tfu_0901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1062716..1064116)
Genome map
AA seq 466 aa AA seqDB search
MAKSPAARKGGPPVAVAVTAALALLIALLSPGVAQAAGLTATVTKESSWDNGYSASVTVR
NDTSSTVSQWEVVLTLPGGTTVAQVWNAQHTSSGNSHTFTGVSWNSTIPPGGTASFGFIA
SGSGEPTHCTINGAPCDEGSEPGGPGGPGTPSPDPGTQPGTGTPVERYGKVQVCGTQLCD
EHGNPVQLRGMSTHGIQWFDHCLTDSSLDALAYDWKADIIRLSMYIQEDGYETNPRGFTD
RMHQLIDMATARGLYVIVDWHILTPGDPHYNLDRAKTFFAEIAQRHASKTNVLYEIANEP
NGVSWASIKSYAEEVIPVIRQRDPDSVIIVGTRGWSSLGVSEGSGPAEIAANPVNASNIM
YAFHFYAASHRDNYLNALREASELFPVFVTEFGTETYTGDGANDFQMADRYIDLMAERKI
GWTKWNYSDDFRSGAVFQPGTCASGGPWSGSSLKASGQWVRSKLQS
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaatcccccgccgcccggaagggcggccctccggtcgctgtcgcggtgaccgcg
gccctcgccctgctgatcgcgctcctctcccccggagtcgcgcaggccgccggtctcacc
gccacagtcaccaaagaatcctcgtgggacaacggctactccgcgtccgtcaccgtccgc
aacgacacctcgagcaccgtctcccagtgggaggtcgtcctcaccctgcccggcggcact
acagtggcccaggtgtggaacgcccagcacaccagcagcggcaactcccacaccttcacc
ggggtttcctggaacagcaccatcccgcccggaggcaccgcctccttcggcttcatcgct
tccggcagcggcgaacccacccactgcaccatcaacggcgccccctgcgacgaaggctcc
gagccgggcggccccggcggtcccggaaccccctcccccgaccccggcacgcagcccggc
accggcaccccggtcgagcggtacggcaaagtccaggtctgcggcacccagctctgcgac
gagcacggcaacccggtccaactgcgcggcatgagcacccacggcatccagtggttcgac
cactgcctgaccgacagctcgctggacgccctggcctacgactggaaggccgacatcatc
cgcctgtccatgtacatccaggaagacggctacgagaccaacccgcgcggcttcaccgac
cggatgcaccagctcatcgacatggccacggcgcgcggcctgtacgtgatcgtggactgg
cacatcctcaccccgggcgatccccactacaacctggaccgggccaagaccttcttcgcg
gaaatcgcccagcgccacgccagcaagaccaacgtgctctacgagatcgccaacgaaccc
aacggagtgagctgggcctccatcaagagctacgccgaagaggtcatcccggtgatccgc
cagcgcgaccccgactcggtgatcatcgtgggcacccgcggctggtcgtcgctcggcgtc
tccgaaggctccggccccgccgagatcgcggccaacccggtcaacgcctccaacatcatg
tacgccttccacttctacgcggcctcgcaccgcgacaactacctcaacgcgctgcgtgag
gcctccgagctgttcccggtcttcgtcaccgagttcggcaccgagacctacaccggtgac
ggcgccaacgacttccagatggccgaccgctacatcgacctgatggcggaacggaagatc
gggtggaccaagtggaactactcggacgacttccgttccggcgcggtcttccagccgggc
acctgcgcgtccggcggcccgtggagcggttcgtcgctgaaggcgtccggacagtgggtg
cggagcaagctccagtcctga

DBGET integrated database retrieval system