KEGG   Thermobifida fusca: Tfu_0941Help
Entry
Tfu_0941          CDS       T00265                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K07131  uncharacterized protein
Organism
tfu  Thermobifida fusca
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Robl_LC7
Motif
Other DBs
NCBI-ProteinID: AAZ54979
JGI: Tfu0941
UniProt: Q47RD8
Position
1109813..1110214
Genome map
AA seq 133 aa AA seqDB search
MSQPVNELNWLITDFANRVPDVAHAIVVSSDGLPLAASAGFPADRADQLAAIASGLSSLT
QGAARVFEGGAVAQTVVEMERGLLLIMAISDGSCLAVLAAAECDLGLVGYEMTLLVERAG
RALTPAARTPGVH
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaccggttaatgaactcaactggctgatcactgacttcgccaatcgtgtgccc
gatgtggctcacgcgattgtggtgtcgtcggacggtctaccgttggcggcttcagccggg
ttccctgctgaccgtgccgaccagttggctgcgatcgcctccggtctctccagcctcaca
caaggtgcagcccgggtctttgaaggcggagcagtcgcgcagaccgtggttgagatggag
cgtgggctgctccttatcatggccatcagcgacggatcatgccttgcggtgctcgctgcc
gccgaatgtgacctcggtctggtcggctacgagatgacactgctcgtagagcgggccggc
cgggcactgactccggcagcacgcactccgggcgtccactga

DBGET integrated database retrieval system