KEGG   Thermobifida fusca: Tfu_0942Help
Entry
Tfu_0942          CDS       T00265                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tfu  Thermobifida fusca
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1110235..1110729
Genome map
AA seq 164 aa AA seqDB search
MVAPPHGRDSGSASWFGDPSASASRPLSDPLAGGEPPTTPQVTGQQWSIGESAPSSLVRP
YAVTRGRTKPKTHLPLEALISTTATARSEFGTLTPECQAITDLCREWRSVAEISALCRIP
LGVARVLVADMAEQGLVQIRSSLNTDSRPNVNLLERVLSGLRKL
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
gtggtggcaccacctcacggtagagactccgggagcgcctcatggtttggcgacccgtca
gccagtgcctcgaggccgctgtccgacccgctagccggtggagaaccgcctaccacccca
caggtcaccgggcagcagtggtccatcggtgaaagcgcgccgagttcgttggtacggcct
tacgcggtgacccgtggccggaccaagccgaagactcatctgccgttggaagcactgatt
tccacgaccgcgacggcgcgtagcgagttcgggacgcttactcccgaatgccaggcgatt
accgacctgtgtcgggagtggcgatcagtggcggagatctctgccctgtgccggataccg
ctcggtgtcgcgcgagttctggtggcggatatggcagaacagggtcttgtgcagatcagg
tcgtcgctgaacaccgacagccggcccaatgtcaacctgcttgaaagggtactcagtgga
cttcgcaagctctag

DBGET integrated database retrieval system