KEGG   Thermobifida fusca: Tfu_0948Help
Entry
Tfu_0948          CDS       T00265                                 

Definition
(GenBank) propionyl-CoA carboxylase
  KO
K01969  
3-methylcrotonyl-CoA carboxylase beta subunit [EC:6.4.1.4]
Organism
tfu  Thermobifida fusca
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Tfu_0948
Enzymes [BR:tfu01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.4  methylcrotonoyl-CoA carboxylase
     Tfu_0948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1116173..1117798)
Genome map
AA seq 541 aa AA seqDB search
MSGTATLTSAIDPTSPAFHANAETNRALAAELRRRLADAARGGPPHARERHKARGKLLAR
ERIDALLDPGTPFLELSPLAAHGMYGPDGNDAPAAGIITGIGRVSGRETVIVANDATVKG
GSYYPMTVKKHLRAQEVALHNHLPCIYLVDSGGAFLPMQDEVFPDRDHFGRIFYNQATMS
QRGIPQIAAVLGSCTAGGAYVPAMSDEAVIVRNQGTIFLGGPPLVKAATGEVVTAEELGG
GDVHARVSGVVDHIADDDAHALAIVRRIVATLGPRPAPAWDVREPRPPAADPAELYGIIP
TDTRTPYDVREVIARLVDASEFTEFKADYGPTLVTGFAHLHGHPVGIIANNGILFSESAL
KGAHFIELCDRRAIPLVFLQNISGFMVGRDYEAGGIAKHGAKMVTAVACARVPKFTVIIG
GSFGAGNYSMCGRAYSPRFLWMWPNARISVMGGEQAASVLATVRRDQKAARGEDWSAEEE
EAFKAPIRARYEEQGNPYYSTARLWDDGVIDPVDTRTVLALALSAARHAPLDPVGYGVFR
M
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggacggccacactcacctccgctatcgacccgaccagccccgccttccacgcc
aacgccgaaaccaaccgcgccctcgccgcggaactccgccgccgcctggccgacgcggcc
cgcggcgggcccccgcacgcccgcgaacgccacaaagcccgcggcaaactcctcgcccgc
gaacggatcgacgccctcctcgacccgggcacgcccttcctcgaactctccccgctcgcc
gcccacggcatgtacggccccgacgggaacgacgcacccgccgcagggatcatcaccggc
atcggacgcgtctccggacgcgaaaccgtcatcgtcgccaacgacgccaccgtcaaaggc
ggcagctactatccgatgaccgtcaaaaaacacctccgcgcccaagaagtcgccctgcac
aaccacctgccgtgcatctacctcgtcgactccggcggcgcgttcctgcccatgcaggac
gaagtcttccccgaccgcgaccacttcggccgcatcttctacaaccaggccaccatgtcg
cagcgcggcatcccgcagatcgccgcggtcctcggctcctgcactgccggcggcgcctac
gtgcccgccatgagcgacgaagccgtcatcgtccgcaaccaaggcaccattttcctcggc
gggcccccgctcgtgaaagccgccaccggcgaagtcgtcaccgcggaagaactcggcggc
ggcgacgtccacgcccgcgtctccggagtcgtcgaccacatcgccgacgacgacgcacac
gccctcgccatcgtccgccgcatcgtcgccaccctcggcccgcggcccgcacccgcctgg
gacgtgcgcgaaccccggccccccgcagccgaccccgcggaactgtacggcatcatcccc
accgacacccgcaccccctacgacgtgcgggaagtcatcgcacggctcgtcgacgccagc
gaattcaccgaattcaaagccgactacgggcccaccctcgtcaccgggttcgcgcacctg
cacggccaccccgtcggcatcatcgccaacaacggcatcctgttctccgaatccgcgctc
aaaggcgcccacttcatcgaactgtgcgaccggcgcgccatccccctcgtcttcctgcag
aacatctccgggttcatggtgggccgcgactacgaagccggcggcatcgccaaacacggc
gcgaaaatggtcaccgccgtcgcctgcgcccgcgtccccaaattcaccgtcatcatcggc
ggctccttcggcgccggaaactacagcatgtgcgggcgcgcctactcgccgcgcttcctg
tggatgtggccgaacgcccgcatctccgtcatgggcggggaacaagccgcctccgtgctc
gccaccgtacgccgcgaccagaaagccgcacgcggcgaagactggtccgctgaagaggaa
gaagcgttcaaagcccccatccgggcgcgctacgaagagcaaggcaacccctactactcc
acggcgcgcctgtgggacgacggcgtcatcgaccccgtcgacacccgcaccgtcctcgcc
ctcgccctctccgccgcccgccacgccccgctcgacccggtgggctacggcgtcttccgc
atgtag

DBGET integrated database retrieval system