KEGG   Thermobifida fusca: Tfu_0961Help
Entry
Tfu_0961          CDS       T00265                                 

Definition
(GenBank) L-alanine dehydrogenase
  KO
K00259  
alanine dehydrogenase [EC:1.4.1.1]
Organism
tfu  Thermobifida fusca
Pathway
Alanine, aspartate and glutamate metabolism
Taurine and hypotaurine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Tfu_0961
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Tfu_0961
Enzymes [BR:tfu01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.1  alanine dehydrogenase
     Tfu_0961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1126833..1127954)
Genome map
AA seq 373 aa AA seqDB search
MRVGVPREIKDHEYRVAITPAGVQELVRHGHDVLIERDAGVGSAISNAEYAAAGARIIDS
ADEVWGAADLVLKVKEPVPEEYHRLRPGQVLFAYLHLAASRDCTEALLKHGVTAIAYETV
QLPDGSLPLLAPMSEIAGRLAPQVGATALQRSNGGRGVLLGGVPGVGPAKVMVLGAGVSG
MNAAQVAAGMGAEVTLLDIDIAKLRRADAVFQGRVRTLASTAYEIERTALESDLIIGAVL
IPGAKAPTLISSDLVAQMKPGTVLVDIAVDQGGCFADSRPTTHSDPTYPVHNTVFYCVSN
MPGAVPTTATQALTKDTLRYALALANKGWRDALADDPALAAGLNTFAGELTNEAVAQAHG
MAARTVTEVVAAG
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgtcggcgtgccccgtgaaatcaaagaccatgaataccgagtagctatcaccccg
gccggcgtccaggagctcgtccggcacggccacgacgtcctcatcgaacgcgacgccggt
gtcggctcggccatcagcaacgccgaatacgcggccgcgggcgcccgcatcatcgacagc
gccgacgaagtgtggggagcggccgacctcgtcctcaaagtcaaagaacccgtccccgag
gaataccaccggctccgccccggccaagtgctcttcgcctacctgcacctggcggcgtcc
cgggactgcaccgaagccctcctcaagcacggagtcaccgcgattgcctacgaaaccgtg
cagcttcccgacgggtccctgcccctgttggcgcccatgtcggagatcgcgggacggctc
gccccccaagtcggcgcgaccgccttgcagcgctccaacggcggccgcggcgtcctgctc
ggcggagtgcccggtgtggggcccgccaaagtcatggtgctcggcgcgggtgtctccggc
atgaacgccgcccaagtcgcggcgggcatgggcgcggaagtcaccctgctcgacatcgac
atcgccaaactgcgccgggcggacgccgtgttccaaggccgggtgcggacgctggcgtcc
accgcctacgagattgaacggaccgccctggaatccgacctcatcatcggagcagtgctc
atccccggcgcgaaagcccccaccctgatcagcagcgacctggtcgcccagatgaaaccc
ggcaccgtgctcgtcgacatcgccgtcgaccaaggcggctgcttcgccgactcgcggccc
accacccactccgaccccacgtacccggtgcacaacacggtgttctactgcgtgtcgaac
atgcccggcgcggtgcccaccacggccacgcaggcgctgaccaaagacacgctgcgctac
gcgctggccctggcgaacaaaggctggcgggacgcgctcgccgacgacccggcgctcgcc
gcaggcctcaacacgttcgcgggagaactcaccaacgaggccgtggcccaagcccacggg
atggcggcgcgcaccgtcaccgaagtcgtggccgcgggatag

DBGET integrated database retrieval system