KEGG   Thermobifida fusca: Tfu_0966Help
Entry
Tfu_0966          CDS       T00265                                 

Definition
(GenBank) caffeoyl-CoA O-methyltransferase
  KO
K00588  
caffeoyl-CoA O-methyltransferase [EC:2.1.1.104]
Organism
tfu  Thermobifida fusca
Pathway
Phenylalanine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Tfu_0966
Enzymes [BR:tfu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.104  caffeoyl-CoA O-methyltransferase
     Tfu_0966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1133489..1134148)
Genome map
AA seq 219 aa AA seqDB search
MTRTSENLSPELHAYLVAHSTPVDEVLTDLAAETERLFPDHVGMQIAPEQGLFLTLLTQL
IGARNIVEVGTFTGYSSICLARGLPNDGTLLACDVSEEWTAVARRYWQRAGVADRIDLRL
APALDTLRALPEEPQFDLAFIDADKESYIAYWEELVPRVRPGGVLLADNVFSHSRVLDPA
QTAARVQAIRDFNVHARDDTRVDLVILPIGDGFTLARRR
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
gtgacacgcacctcagaaaacctcagtccggaactgcacgcctacctggtcgcgcacagc
acccccgtcgacgaagtgctgaccgacctggccgcggaaaccgaacggctcttccccgac
cacgtcggcatgcagatcgcccccgaacaaggactgttcctcaccctgctcacccagctc
atcggggcacgcaacatcgtcgaagtcggcaccttcaccgggtattcgtcgatctgcctg
gcccgcggcctccccaacgacggcaccctgctcgcctgcgacgtcagcgaagaatggacc
gcggtggcgcgccgctactggcagcgggccggggtcgccgaccggatcgacctgcggctc
gcccccgccctcgacacgctgcgcgccctccccgaagaaccccagttcgacctggcgttc
atcgacgccgacaaagagtcctacatcgcctactgggaagaactcgtgccgcgggtgcgg
cccggcggggtgctgctcgccgacaacgtgttctcgcacagccgggtcctcgaccccgcg
cagaccgcggcccgcgtgcaagccatccgcgacttcaacgtgcacgcccgcgacgacacg
cgggtcgacctggtcatcctccccatcggcgacggcttcaccctggcgcggcgcagatag

DBGET integrated database retrieval system